(data stored in ACNUC7421 zone)

EMBL: CP001349.PE166

CP001349.PE166       Location/Qualifiers
FT   CDS_pept        complement(185765..186592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55218"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G5"
FT                   /inference="similar to AA sequence:KEGG:M446_4587"
FT                   /protein_id="ACL55218.1"
FT                   /translation="MRSILTAPSIGRWLPVLALAAGLSAAPAGAATLEATYRVTLAGLS
FT                   VGKAALRMEITDRRRYELHLDAALNGLARMLWGGQGSAQSRGVLDGAAVRPRAFQLDAL
FT                   YGGTPISERIMLDDGRITSVSMSPDARVRPDRVPPRPGDDRNVVDPLSALIGPQLSPPG
FT                   APTPRDCERTLPVHDGTARFDIPLGEGEAQTFGGTGYAGPVVLCRARYVPLSGHRPKRW
FT                   VVQYMRENRDLRVWLAPVGHSRVLAPVRIEVGTTFGTAMAEVTRWRIEEAASR"
     atgcgctcga tcctgaccgc gccatccatc ggacgatggc tgcccgtcct ggctctggcc        60
     gccggactgt ccgcggcgcc agccggcgcc gcgacgctgg aggcgaccta ccgcgtcacg       120
     ctcgccggat tgtccgtcgg gaaagccgcc ctgcggatgg agatcaccga caggcggcgt       180
     tacgagctgc atctcgatgc cgccctgaac gggttggcgc gcatgctctg gggcggccaa       240
     ggatcggccc agtcccgggg cgtgctcgac ggggcggccg tccgcccgcg ggcctttcag       300
     ctcgatgccc tctacggcgg cacgccgatc agcgagcgga tcatgctcga tgacggccgg       360
     atcacctccg tcagcatgtc ccccgacgcg cgggtgcgac cggaccgggt gccgccgcgt       420
     ccgggcgacg accgcaacgt ggtcgatccg ctctcggccc tgatcggccc gcagctcagc       480
     cctccgggcg cgccgacccc gcgcgactgc gagcgcaccc tgccggtgca tgacggtacg       540
     gcgcgcttcg acattcccct cggcgagggg gaggcgcaga cctttggcgg cacgggctat       600
     gcgggacccg tggtgctgtg ccgggcgcgc tacgttcccc tctcgggcca tcggccgaag       660
     cgttgggtcg tgcagtacat gcgcgagaac cgcgacctgc gggtctggct cgctccggtc       720
     gggcattccc gcgtcctcgc tcccgtacgg atcgaggtcg gcaccacctt cggcaccgcc       780
     atggccgagg tgacccgctg gcggatcgag gaagccgcct cccgctga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page