(data stored in ACNUC7421 zone)

EMBL: CP001349.PE167

CP001349.PE167       Location/Qualifiers
FT   CDS_pept        complement(186819..187124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0173"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55219"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G6"
FT                   /inference="similar to AA sequence:KEGG:M446_3665"
FT                   /protein_id="ACL55219.1"
FT                   /translation="MTSDDKINGLTVLSANHGEMIARLSEAQADVAAKQVALQMAIGFL
FT                   ARILRSIDSDHYRHELAGYLGMLEDALTRDDPDSDLARRVLETVRATLETGEGDED"
     atgacctcgg acgacaagat caacggcctc accgtgctgt cggcgaacca cggcgagatg        60
     atcgcccggc tctcggaggc gcaggccgat gtcgcggcca agcaggtggc gttgcagatg       120
     gcgatcgggt tcctggcacg gatcctgcgc tcgatcgatt ccgatcacta ccggcatgag       180
     ctcgccggct atctcggcat gctggaggat gcgctgacgc gcgacgaccc ggattccgac       240
     cttgcccggc gggttctcga aaccgtgcgg gcgaccctgg agaccgggga gggagacgag       300
     gactaa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page