(data stored in ACNUC7421 zone)

EMBL: CP001349.PE168

CP001349.PE168       Location/Qualifiers
FT   CDS_pept        complement(187247..189949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0174"
FT                   /product="aconitate hydratase 1"
FT                   /note="TIGRFAM: aconitate hydratase 1; PFAM: aconitate
FT                   hydratase domain protein; KEGG: met:M446_3664 aconitate
FT                   hydratase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55220"
FT                   /db_xref="GOA:B8I9G7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G7"
FT                   /inference="protein motif:TFAM:TIGR01341"
FT                   /protein_id="ACL55220.1"
FT                   /translation="MASIDSFKSRQTLQVGSKSYTYYSIAEAEKNGLPDASRLPFSMKV
FT                   LLENLLRFEDDRSVKKADIEAVTAWLGNRGEVETEIAFRPSRVLMQDFTGVPAVVDLAA
FT                   MRDAMVALGGDPKKINPLVPVDLVIDHSVIVDEFGTPKALADNVALEYQRNGERYTFLK
FT                   WGQAAFDNFSVVPPGTGICHQVNLEYLAQTVWTKAFENGQELAYPDSLVGTDSHTTMVN
FT                   GLAVLGWGVGGIEAEAAMLGQPLSMLIPEVVGFKLSGKLPEGTTATDLVLTVTQMLRKK
FT                   GVVGKFVEFYGPGLDDMAVADRATISNMAPEYGATCGFFPVDTRTLDYLRVTGRSDERI
FT                   ALVEAYAKAQGMWRDAATPDPVFTDTLELDLGDVKPSLAGPKRPQDRVLLDSAKPGFAA
FT                   SMETEFRKAADLAKRYPVEGANFDLGHGDVVIAAITSCTNTSNPSVMIGAGLLARNAIA
FT                   KGLRSKPWVKTSLAPGSQVVAEYLEKAGLQKSLDALGFNLVGFGCTTCIGNSGPLPAPI
FT                   SKAINDNDIVAAAVLSGNRNFEGRVNPDVRANYLASPPLVVAYALAGSLQVDLTRDPIG
FT                   TGSDGQPVYLKDIWPSSAEVNAFIEQTITSSLFKSRYADVFGGDANWKAVEVTPAQTFS
FT                   WNSGSTYVQNPPYFVGMQKTPAPVTDIVGARILGLFLDSITTDHISPAGNIRAASPAGK
FT                   YLQEHQVRVQDFNQYGTRRGNHEVMMRGTFANIRIKNQMVRDESGNVVEGGWTLYQPGG
FT                   EKMFIYDAAMRYQAEGTPLVVFAGKEYGTGSSRDWAAKGTKLLGVRAVIAESFERIHRS
FT                   NLVGMGVVPLVFQGDTTWDSLGLKGDETVTIRGLAGDLKPRQTLTAEITAADGTTKQVP
FT                   LTCRIDTLDELEYFRNGGILPYVLRQLAA"
     gtggcatcca tcgacagctt caagtcccgt cagaccctgc aggtcggctc gaagagctac        60
     acctattact cgatcgccga ggccgagaag aacggccttc cggatgccag ccggctgccc       120
     ttctcgatga aggtgctgct ggagaacctc ttgcgcttcg aggacgaccg ctcggtcaag       180
     aaggccgata tcgaggccgt gaccgcctgg ctcggtaatc gcggcgaggt cgaaaccgag       240
     atcgcgttcc ggccctcgcg cgtgctgatg caggacttca ccggcgtgcc ggcggtggtc       300
     gacctcgcgg cgatgcgcga cgccatggtg gcgctcggcg gcgacccgaa gaagatcaac       360
     ccgctcgtgc cggtcgacct cgtcatcgac cactcggtca tcgtcgacga gttcggcaca       420
     ccgaaggcgc tggccgacaa cgtcgcgctc gaataccagc gcaatggcga gcgctatacc       480
     ttcctgaaat ggggccaggc ggcgttcgac aatttttcgg tggtgccgcc cggcaccggc       540
     atctgccatc aggtcaacct cgaatacctc gcccagacgg tgtggaccaa ggcgttcgag       600
     aacgggcagg aactcgccta tccggacagt ctggtcggca ccgactcgca caccacgatg       660
     gtgaacggcc ttgcggtgct cggctggggc gtcggcggca tcgaggccga ggcggccatg       720
     ctcggccagc ccctgtcgat gctgatcccg gaggtggtcg gcttcaagct ctcgggcaag       780
     ctgccggagg gcaccaccgc caccgacctc gtgctcaccg tcacgcagat gctgcgcaag       840
     aagggcgtgg tcggcaagtt cgtggagttc tacggcccgg gcctcgacga catggccgtc       900
     gccgaccgcg ccacgatctc caacatggcg cccgaatacg gcgccacctg cggcttcttc       960
     ccggtcgata cccggaccct cgactacctg cgcgtcaccg gccgctccga cgagcgcatc      1020
     gcgctggtcg aggcctacgc caaggcgcag gggatgtggc gggacgcggc gaccccggac      1080
     ccggtcttca ccgacacgct cgaactcgac ctcggcgacg tgaagccctc cctcgccggg      1140
     ccgaagcgcc cgcaggaccg cgtcctcctc gattccgcca agccgggctt tgccgcctcg      1200
     atggagaccg agttccgcaa ggccgccgac ctcgccaagc gctatccggt cgagggcgcg      1260
     aatttcgacc tcggtcacgg cgacgtggtg atcgcggcaa tcacctcctg caccaacacc      1320
     tcgaacccga gcgtgatgat cggcgcgggg ctgctcgccc gcaacgcgat cgccaagggc      1380
     cttcgctcga agccctgggt gaagacctcg ctcgcgcccg gctcgcaggt ggtcgcggag      1440
     tacctggaga aggccggcct gcagaagagc ctcgacgcgc tcggcttcaa cctcgtcggc      1500
     ttcggctgca ccacctgcat cggcaattcc ggcccgctgc cggcgccgat ctcgaaggcc      1560
     atcaacgaca acgacatcgt tgcggcggcg gtgctctcag gcaaccgcaa cttcgagggc      1620
     cgggtgaacc cggacgtgcg ggcgaactat ctcgcctcgc cgcccctggt ggtcgcctac      1680
     gcgctcgccg gctcgctgca ggtcgacctg accagggacc cgatcggcac cggttcggac      1740
     gggcagcccg tctacctgaa ggacatctgg ccctcctcgg ccgaggtgaa cgccttcatc      1800
     gagcagacca tcacgtcgag cctgttcaag tcgcgctacg ccgacgtctt cggcggcgac      1860
     gccaactgga aggcggtcga ggtcacgccg gcccagacct tctcgtggaa ctcaggctcg      1920
     acctacgtgc agaacccgcc ctatttcgtg ggcatgcaga agaccccggc gccggtcacc      1980
     gacatcgtcg gcgcgcgcat cctcggcctc ttcctcgact cgatcaccac cgaccacatc      2040
     tcgcccgccg gcaacatccg ggcggcctcg ccggccggca agtacctgca ggagcatcag      2100
     gtccgcgtgc aggacttcaa ccagtacggc acgcggcgcg gcaatcacga ggtcatgatg      2160
     cgaggcacct tcgccaatat ccgcatcaag aaccagatgg tccgcgatga atccggcaat      2220
     gtggtggagg gcggctggac cctctaccag ccggggggcg agaagatgtt catctacgat      2280
     gcggcaatgc gctaccaggc cgagggcacg ccgctcgtgg tcttcgccgg caaggaatac      2340
     ggcacgggct cctcgcgcga ctgggcggcc aagggcacga agttgctcgg tgtgcgcgcg      2400
     gtcattgcgg agagcttcga gcgcatccac cgctcgaatc tcgtcggcat gggcgtagtg      2460
     ccgctggtct tccagggcga cacgacctgg gattcgctcg gcctcaaggg cgacgagacc      2520
     gtcaccatcc ggggcctcgc gggcgacctg aagccgcgcc agacgctcac cgccgagatc      2580
     acggcggcgg acggcacgac gaagcaggtg ccgctcacct gccggatcga taccctcgac      2640
     gagctggagt atttccgcaa cggcggcatc ctgccctacg tgctgcgcca gctcgccgcg      2700
     tga                                                                    2703
//

If you have problems or comments...

PBIL Back to PBIL home page