(data stored in ACNUC7421 zone)

EMBL: CP001349.PE169

CP001349.PE169       Location/Qualifiers
FT   CDS_pept        190529..191176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0175"
FT                   /product="heme exporter protein CcmA"
FT                   /note="KEGG: met:M446_3663 heme exporter protein CcmA;
FT                   TIGRFAM: heme exporter protein CcmA; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55221"
FT                   /db_xref="GOA:B8I9G8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G8"
FT                   /inference="protein motif:TFAM:TIGR01189"
FT                   /protein_id="ACL55221.1"
FT                   /translation="MRLIAKGLACRRSGRRIFSGLSFTLDPGEALIVTGRNGAGKSSLL
FT                   AILSGRLSPEAGSLRAEDVGERTIPECLHGVGHRDGLKSALTAEENLAFARDLLGAATL
FT                   APREALARMGLAHAAGLPVAYLSAGQRRRVALARLLVCRRPLWLLDEPTAALDAASQAV
FT                   LAGLMRDHLAEGGLVVAATHQALGLTTARELSIEAFRPAAAAHTDPFAETAR"
     atgcgcctga tcgccaaggg gctcgcctgc cgccgctcgg gacggcgcat cttctccggc        60
     ctctccttca ccctggatcc gggcgaggcg ctgatcgtca ccggccgcaa cggagccggc       120
     aaatcctcgc tgctcgccat cctgtccggc cgcctgtcgc cggaggccgg atcgctgcgg       180
     gcggaggatg tcggcgagcg caccattccc gaatgcctgc acggcgtcgg tcaccgcgac       240
     gggctgaaga gcgcgctcac cgcggaggag aacctcgcct tcgcccgcga tctcctcggc       300
     gccgcgacgc tcgcgccccg ggaggcgctc gcccggatgg gcctcgccca tgcggcgggc       360
     ctgccggtcg cttatctgtc ggccggccag cggcgacggg tcgcgctcgc gcggctcctc       420
     gtctgccgcc gcccgctctg gctcctcgac gagccgaccg ccgccctcga cgccgcctcg       480
     caggccgtcc tcgccggatt gatgcgcgat cacctggccg agggcgggct cgtggtcgcc       540
     gcgacccacc aggcgctcgg cctcacgacg gcccgggaac tgtcgatcga ggctttccgt       600
     cccgccgcag cggcgcacac cgaccccttc gccgagaccg cccgatga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page