(data stored in ACNUC7421 zone)

EMBL: CP001349.PE17

CP001349.PE17        Location/Qualifiers
FT   CDS_pept        19635..20654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0018"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   ErfK/YbiS/YcfS/YnhG family protein; KEGG: met:M446_0013
FT                   ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55069"
FT                   /db_xref="GOA:B8IT07"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT07"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACL55069.1"
FT                   /translation="MRRAIYGVAACLLLIGGAGAAETALDREAVNTARFEPDRQTRETG
FT                   KQPDPLLVKVQVLLDRARFSPGVIDGRSGDNLEGALKAFAEARGMKASGRLDGALWDAL
FT                   AVTSQDPVLGDYTITEKDTAGPFVKEIPAKMEEQADLKALAYTGPAEMLAERFHMSRAL
FT                   FEALNPGKAFDKPGTLVTVAAVAPLELERPAAKSLPEEPKVQRIVVDKEALQVRAYGGD
FT                   GALLAVYPASIGSEEKPAPQGTFKVKGIVFDPDYTYDPKYGFAGVHAKHKFTIRPGPNN
FT                   PVGLVWIDLSAESYGIHGTPDPEKIGKTESHGCIRLTNWDARDLARHVVKGATVEIGG"
     atgcgacggg cgatctacgg agtggcggca tgtctcctgc tgatcggagg cgcgggcgcg        60
     gccgagaccg ccctcgaccg cgaggccgtg aatacggcgc ggttcgagcc cgaccgccag       120
     accagggaaa ccggcaagca gcccgatccg ctcctcgtca aggtgcaggt gctcctcgac       180
     cgggcccgct tctccccggg cgtcatcgat ggccgctccg gcgacaatct cgagggcgcg       240
     ctcaaggcct tcgctgaggc caggggcatg aaggcgtcgg gccgcctcga cggggcgctc       300
     tgggacgccc tcgcggtgac gagccaggat ccggtgctcg gcgactacac catcaccgag       360
     aaggacacgg ctggcccctt cgtgaaggag atccccgcga agatggagga gcaggccgat       420
     ctcaaggccc tggcctatac cggcccggcc gagatgctgg ccgagcgctt ccacatgagt       480
     cgcgcgctgt tcgaggccct gaacccgggc aaggcgttcg acaagcccgg gactctggtc       540
     acggtggcgg ccgtcgcccc gctggagctg gagcggcccg ccgccaagag cctgcccgag       600
     gagccgaaag tccagcggat cgtcgtcgac aaggaggccc ttcaggtgcg ggcctatggg       660
     ggcgacggcg cgctcctcgc cgtctacccg gcctcgatcg gcagcgagga gaaacccgcc       720
     ccgcagggca ccttcaaggt gaagggaatc gtcttcgatc cggactacac ctacgatccg       780
     aaatacggct tcgcgggggt gcacgcgaag cacaagttca cgatcaggcc cggtccgaac       840
     aatccggtcg gcctcgtctg gatcgacctc tcggcggaat cctacggcat tcacggcacg       900
     ccggacccgg agaaaatcgg taagacggaa tcgcatggct gcatccgcct gaccaactgg       960
     gatgcccgcg acctcgcccg ccatgtcgtc aagggcgcga ccgtggagat cggcggttga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page