(data stored in ACNUC7421 zone)

EMBL: CP001349.PE170

CP001349.PE170       Location/Qualifiers
FT   CDS_pept        191173..191841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0176"
FT                   /product="heme exporter protein CcmB"
FT                   /note="TIGRFAM: heme exporter protein CcmB; PFAM:
FT                   cytochrome c-type biogenesis protein CcmB; KEGG:
FT                   met:M446_3662 heme exporter protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55222"
FT                   /db_xref="GOA:B8I9G9"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G9"
FT                   /inference="protein motif:TFAM:TIGR01190"
FT                   /protein_id="ACL55222.1"
FT                   /translation="MIRPFLAVLLRDLRLAGRIGGSGALSLVFFLMIVVLVPFALGPDL
FT                   NLLSRIGPAILWLAAVLATLIGLDRLFQADEEDGSLDLLTGAPVPLELVVLAKALAHWL
FT                   TTGLPLALAAPLFGLLVALTPSAMAATSLTLLVGTPALTFIGAVGAALTASIRRGGLIL
FT                   AVVVLPLMIPTLIFGVSAADSATGGTVPFATPLGILGALSLVAGVVGTLGAAAALRWSE
FT                   "
     atgatccgtc ccttcctggc ggtgctcctg cgcgacctgc ggctggccgg ccgcatcggc        60
     ggctcgggcg cgctctcgct cgtcttcttc ctgatgatcg tggtgctggt gcctttcgcc       120
     ctcgggcccg acctcaacct cctgtcgcgg atcggcccgg cgatcctctg gctcgccgcc       180
     gtgctcgcca ccctgatcgg gctcgaccgc ctgttccagg ccgacgagga ggacggctcc       240
     ctcgacctcc tcaccggggc ccccgtgccg ctcgaactcg tggtcctggc caaggccctc       300
     gcccattggc tgaccacggg cctgccgctc gcgctcgccg ccccgctctt cgggctcctc       360
     gtcgccctca cgccgagcgc gatggcggcg acgagcctga cgctcctcgt cggcacgccc       420
     gcgctcacct tcatcggagc ggtcggcgca gcgctcacgg cgtcgatccg ccgcggcggg       480
     ctgatcctcg ccgtggtggt gctgcccctg atgatcccga ccctgatctt cggggtctcg       540
     gcggcggatt ccgccaccgg cggcaccgtg cccttcgcga cgccgctcgg gatcctgggc       600
     gcgctcagcc tcgtcgccgg cgtcgtgggg acgctcggcg ccgcggcagc cctgcgctgg       660
     agcgagtga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page