(data stored in ACNUC7421 zone)

EMBL: CP001349.PE171

CP001349.PE171       Location/Qualifiers
FT   CDS_pept        complement(191851..192024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0177"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   met:M446_3661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55223"
FT                   /db_xref="GOA:B8I9H0"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H0"
FT                   /inference="protein motif:PFAM:PF07043"
FT                   /protein_id="ACL55223.1"
FT                   /translation="MLKWALIFFVISLVAGALGFTNVAAGARGIARLLFGLFLAIAVVI
FT                   VIFAFAVGQAVF"
     atgctgaaat gggccctcat cttcttcgtg atctcgctcg tcgcgggcgc gctcggcttc        60
     accaacgtgg cggcgggcgc ccgcggcatc gcccgcctgc tgttcggcct cttcctcgcc       120
     atcgcggtcg tgatcgtgat cttcgccttc gcggtcgggc aggcggtgtt ctga             174
//

If you have problems or comments...

PBIL Back to PBIL home page