(data stored in ACNUC7421 zone)

EMBL: CP001349.PE172

CP001349.PE172       Location/Qualifiers
FT   CDS_pept        192140..192904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0178"
FT                   /product="heme exporter protein CcmC"
FT                   /note="TIGRFAM: heme exporter protein CcmC; PFAM:
FT                   cytochrome c assembly protein; KEGG: met:M446_3660 heme
FT                   exporter protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55224"
FT                   /db_xref="GOA:B8I9H1"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H1"
FT                   /inference="protein motif:TFAM:TIGR01191"
FT                   /protein_id="ACL55224.1"
FT                   /translation="MAQGLFTRLAQPSHFLRWSGAALPWISGLAALLLAAGLYLSVFVA
FT                   PADYQQGETVRIMFIHVPAAWLGVFFYGAMAVSALGTLVWRHPLADVAQRAAAPVGAAF
FT                   TLICLVTGSLWGKPMWGTYWVWDARLTSMLVLLLIYCGLLALWRTIEDPGRAARAVAIL
FT                   TLVGAVNLPIIKFSVNWWSTLHQPASILRMGGPTIHPTMLYPLLVMIAAFSVLGIALHL
FT                   AAMRTEILRRRVRTLAILEAERLDGLPAPQAA"
     atggcacaag gcctcttcac ccggctggcc cagccgagcc acttcctgcg ctggtcgggc        60
     gccgccctgc cctggatctc cgggctcgcg gccctgcttc tggccgccgg cctctatctc       120
     tccgtcttcg tcgcgcccgc ggattatcag cagggcgaga cggtgcggat catgttcatc       180
     cacgtcccgg cggcgtggct gggggtgttc ttctacggtg ccatggcggt gtcggccctg       240
     ggcacgctcg tctggcgcca ccccctggcc gacgtggcgc agcgcgccgc cgcgcccgtg       300
     ggcgccgcct tcacgctgat ctgcctcgtc accggctcgc tctggggcaa gccgatgtgg       360
     ggcacctact gggtgtggga cgcgcgcctg acctcgatgc tggtgctgct cctgatctat       420
     tgcgggctcc tcgccctgtg gcggacgatc gaggatccgg gccgggcggc ccgcgccgtc       480
     gccatcctca ccctggtcgg cgccgtgaac ctgccgatca tcaagttctc ggtgaactgg       540
     tggtcgacgc tgcaccagcc ggcctcgatc ctgcggatgg gcggcccgac cattcatccc       600
     accatgctct acccgctgct ggtgatgatc gccgccttct cggtgctcgg catcgcgctg       660
     catctcgccg cgatgcgcac cgagatcctg cgccggcggg tgcgcacgct cgcgatcctg       720
     gaggccgagc gcctcgacgg cctgccggcg ccccaggcgg cctga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page