(data stored in ACNUC7421 zone)

EMBL: CP001349.PE173

CP001349.PE173       Location/Qualifiers
FT   CDS_pept        192932..193078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0179"
FT                   /product="heme exporter protein CcmD"
FT                   /note="TIGRFAM: heme exporter protein CcmD; PFAM: Heme
FT                   exporter protein D (CcmD); KEGG: met:M446_3659 heme
FT                   exporter protein CcmD"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55225"
FT                   /db_xref="GOA:B8I9H2"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H2"
FT                   /inference="protein motif:TFAM:TIGR03141"
FT                   /protein_id="ACL55225.1"
FT                   /translation="MDFGPHATFIIGAYGFTALVVGAMILHAILDHRAQRRALDRLQGG
FT                   RGA"
     gtggatttcg gaccgcacgc cactttcatc atcggagcct acggcttcac ggctctcgtc        60
     gtcggagcga tgatcctgca cgcgatcctc gatcatcgcg cccagcggcg cgccctcgac       120
     cggcttcagg gcgggagagg cgcgtga                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page