(data stored in ACNUC7421 zone)

EMBL: CP001349.PE174

CP001349.PE174       Location/Qualifiers
FT   CDS_pept        193075..193662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0180"
FT                   /product="periplasmic protein thiol/disulphide
FT                   oxidoreductase DsbE"
FT                   /note="TIGRFAM: periplasmic protein thiol/disulphide
FT                   oxidoreductase DsbE; PFAM: alkyl hydroperoxide reductase/
FT                   Thiol specific antioxidant/ Mal allergen; Redoxin domain
FT                   protein; Thioredoxin domain; KEGG: met:M446_3658
FT                   periplasmic protein thiol--disulphide oxidoreductase DsbE"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55226"
FT                   /db_xref="GOA:B8I9H3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H3"
FT                   /inference="protein motif:TFAM:TIGR00385"
FT                   /protein_id="ACL55226.1"
FT                   /translation="MSATEESEGASPRRGLLFLLPLLVFAALAGLFLGRLLTTGYDPSA
FT                   VPSALIGKPVPAFSLPALTGLTADGQPVPGLSSDDLKGKVTVLNVWASWCTPCQAEHPM
FT                   LMRLSQDGVNLVGIDYKDAPENGRRFLGRHGNPFRAVGMDESGRTGIDFGVYGVPETFV
FT                   IGPDGRIRDKLVGILTPENYAGFLEKVRAAAK"
     gtgagcgcga cagaggagag cgagggcgcc tcgccccggc gggggctgct gttcctgctc        60
     ccgcttctcg tcttcgcggc gctcgcgggc ctcttcctcg gccggctcct gaccactggc       120
     tacgatccct ccgcggtgcc gtccgccctg atcggcaagc cggtcccggc cttcagcctg       180
     ccggcgctga cgggcctgac cgccgacggg cagccggtgc cgggcctgtc gagcgacgat       240
     ctcaagggca aggtcacggt cctcaacgtc tgggcctcgt ggtgcacgcc ctgccaagcc       300
     gagcatccga tgctgatgcg cctctctcag gacggcgtga acctcgtcgg catcgactac       360
     aaggacgcgc cggagaacgg ccgccgcttc ctcgggcggc acggcaaccc cttccgcgcg       420
     gtcggcatgg acgagagcgg gcggacgggc atcgatttcg gcgtctacgg cgtgccggaa       480
     accttcgtga tcggcccgga cggtcgcatc cgcgacaagc ttgtcgggat cctcacaccc       540
     gagaactatg cgggcttcct ggagaaggtg cgcgcggccg cgaagtga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page