(data stored in ACNUC7421 zone)

EMBL: CP001349.PE175

CP001349.PE175       Location/Qualifiers
FT   CDS_pept        193897..194949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0181"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: rpe:RPE_4214 transposase IS116/IS110/IS902 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55227"
FT                   /db_xref="GOA:B8I9H4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H4"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACL55227.1"
FT                   /translation="MSEIIRIGLDTSKSVFQLHGVDAAERPVLKLKLSRSKMLAFFAQQ
FT                   PPCLVALEACGASHHWARTLAGLGHTVRLIAPQHVKPYVPGSKTDAADAAGLCEAVSRP
FT                   QMRFVPVKTAEQQAALMLTGLREQWLKRRTQVSNSLRGYAAEFGLAAPQGLARLAELVA
FT                   RLAEDPRVPALARPLFAALWAEYQEIEARVQEADRQLKVWQRGNASCRRLSAVPGIGPV
FT                   GAALLVLKTPAPQAFRSGRDFAAWLGLTPKDHATAGKPRLGGITRAGDEQLRSVLVAGA
FT                   MAVLRQLKPESAGLAGWLTRLVARKARRLVAVALANKLARIAWRLLVSGASYDPARAGP
FT                   PMGGAEPARA"
     atgagcgaga ttatccgcat tgggctggat acgtccaagt ctgttttcca gctgcacggg        60
     gtcgatgcgg ccgagcggcc ggtgctgaag ctgaagctgt cgcgcagcaa gatgctggcc       120
     ttcttcgccc agcagccgcc ctgcctggtg gcgctggaag cctgcggggc ctcgcatcac       180
     tgggcccgca ccctggccgg gctgggccac acggtgcgcc tgatcgcgcc ccagcacgtc       240
     aagccctacg tgcccggctc caagaccgac gcggccgatg cggcgggcct gtgcgaggcg       300
     gtcagccggc cgcagatgcg cttcgtgccg gtcaagaccg ccgagcagca ggcggcgctg       360
     atgctcacgg gcctgcgcga gcaatggctc aagcggcgca cccaggtcag caacagcctg       420
     cgcgggtatg cggccgagtt cgggctggcg gcgcctcagg ggctggcccg tctcgcggaa       480
     ctggtcgcgc gcctggccga ggacccgcgc gtgccggctc tggcccgccc gctgtttgcg       540
     gcgctgtggg ccgagtacca ggagatcgag gcccgggtgc aggaggccga ccgccagctc       600
     aaagtgtggc agcggggcaa cgccagctgc cggcggctga gcgccgtgcc ggggatcggt       660
     ccggtgggcg cggcgctgct ggtgctgaag acgccggccc cccaggcgtt ccgcagcggg       720
     cgggactttg cggcctggct ggggctgacg cccaaggatc acgcgaccgc gggcaagccg       780
     cggctgggcg ggatcacgcg ggcgggcgac gagcaactgc gcagcgtgct ggtggccggc       840
     gcgatggcgg tgctgcgcca gctcaagccg gagagcgcgg ggctggcggg ctggctgacg       900
     cggctggtgg cgcgcaaggc gcggcggctg gtggcggtgg cgctggccaa caagctggcg       960
     cggatcgcct ggcggctgtt ggtgagcggg gcgagctacg acccggcccg ggccggcccg      1020
     ccgatgggag gggcggagcc ggcccgggcc tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page