(data stored in ACNUC7421 zone)

EMBL: CP001349.PE176

CP001349.PE176       Location/Qualifiers
FT   CDS_pept        complement(195284..195994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0182"
FT                   /product="transcription activator effector binding"
FT                   /note="PFAM: transcription activator effector binding;
FT                   KEGG: met:M446_3657 transcription activator effector
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55228"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H5"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ACL55228.1"
FT                   /translation="MTVSRLPLTALGLVLALAAGPGAPRAQQPPAQANPLPTTTDPGQG
FT                   SRPGEAPQPPLPEKAVPPAPPPAGARQTLVQAPGDPSDVDEVTLPAKPVAIVSGNAKWD
FT                   AAVPTLRDSFARIESDLAKAGIKAVGRPVAVFTRTDDDGFQYEAMIPIEQVPDPKPAGL
FT                   PAELRFGSTPSGKALRFVHKGAYDEIDQTYETVTAYLDAKGIIVQDAFVEEYLTDLKSA
FT                   SDTGLEVNIYALPK"
     gtgactgttt cccgtctccc gctgaccgcg ctcggcctcg tcctcgccct tgcggctggg        60
     cccggcgcgc cgcgtgccca gcagccgccc gcgcaggcca atccgctgcc gacgaccacc       120
     gatccgggac agggctcccg gcccggcgag gccccgcagc cgccgctgcc cgagaaggcg       180
     gtgccgcccg ctccgccgcc cgccggggcg cgccagaccc tcgtccaggc accgggcgac       240
     ccctccgacg tcgacgaggt cacgctgccg gccaagcccg tggcgatcgt ctcgggcaat       300
     gccaagtggg atgcggcggt gccgaccctg cgcgacagct tcgcccgcat cgagtccgac       360
     ctcgccaagg cgggcatcaa ggcggtcggg cggccggtcg cggtcttcac ccgcacggat       420
     gacgacggct tccagtacga ggcgatgatc ccgatcgagc aggtgcccga tccgaagccg       480
     gccggccttc cggccgagct gcgcttcggc agcacgccga gcggcaaggc tctgcgcttc       540
     gtgcacaagg gcgcctacga cgagatcgac cagacctacg agaccgtgac cgcctatctc       600
     gacgccaagg gcatcatcgt ccaggacgcc ttcgtggagg aatatctgac ggacctgaag       660
     agcgcgtccg ataccgggct ggaggtcaac atctacgcgc tgccgaaata g                711
//

If you have problems or comments...

PBIL Back to PBIL home page