(data stored in ACNUC7421 zone)

EMBL: CP001349.PE177

CP001349.PE177       Location/Qualifiers
FT   CDS_pept        196165..197046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0183"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: met:M446_3656
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55229"
FT                   /db_xref="GOA:B8I9H6"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I9H6"
FT                   /inference="protein motif:PFAM:PF01678"
FT                   /protein_id="ACL55229.1"
FT                   /translation="MSPLAHRRFLKMNGLGNEIVVLDLRGTPHIVQPQEARAIAADPRS
FT                   RFDQLMVLHDPVTAGTDAALRIYNTDGSESGACGNGTRCVAWAMLEDPVMGRPAERLTL
FT                   QSRAGLLAVTRVSATDFTVDMGPPRLRWDEIPLAEPFPDTRRIELQIGPIDDPILHSPG
FT                   VVSMGNPHAVFFVDRDPASYDLARIGPLLEAHPIFPERANISVAQVRGPEHIVLRVWER
FT                   GAGLTRACGSAACAALVAAARLRLTGRRAVVTLPGGDLVIDWGEDDHVRMTGPTELEWE
FT                   GTLAPSLFAGAA"
     atgtcccctc tcgcgcatcg ccggttcctg aagatgaacg gcctcggcaa cgagatcgtg        60
     gtgctcgacc tgcgcggcac gccccacatc gtgcagccgc aggaggcgcg ggcgatcgcg       120
     gccgatccgc gctcgcgctt cgaccagttg atggtgctgc acgatcccgt cacggccggg       180
     accgacgcgg cgttgcgcat ctacaacacg gacggctcgg aatccggcgc ctgcggcaac       240
     ggcacgcgct gcgtcgcctg ggcgatgctg gaggaccccg tgatggggcg cccggccgag       300
     cgcctgaccc ttcagagccg ggcggggctt ctcgccgtca cgcgcgtctc ggccaccgac       360
     ttcaccgtcg atatggggcc gccgcggctg cgctgggacg agatcccgct tgcggagcct       420
     tttccggaca cgcggcggat cgagctgcag atcggcccga tcgacgatcc gatcctgcat       480
     tcgcccgggg tcgtcagcat gggcaacccg cacgcggtgt tcttcgtcga ccgcgacccg       540
     gcgagctacg atctcgcccg catcggcccg ctgctcgaag cccatccgat cttcccggag       600
     cgcgccaaca tctcggtcgc gcaggtgcgg ggccccgagc acatcgtcct gcgggtctgg       660
     gagcgcggcg ccggactcac ccgggcctgc ggctcggcgg cctgtgcggc gctggtggcc       720
     gccgcccgcc tgcgcctcac cgggcgccgt gccgtggtga cgctgccggg cggcgatctc       780
     gtcatcgact ggggcgagga cgaccacgtc cgcatgaccg gcccgaccga actcgaatgg       840
     gagggcacgc tcgcgccgtc cctgttcgcc ggggccgcct ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page