(data stored in ACNUC7421 zone)

EMBL: CP001349.PE178

CP001349.PE178       Location/Qualifiers
FT   CDS_pept        197046..198284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0184"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /note="KEGG: met:M446_3655 MiaB-like tRNA modifying enzyme;
FT                   TIGRFAM: RNA modification enzyme, MiaB family; MiaB-like
FT                   tRNA modifying enzyme; PFAM: Radical SAM domain protein;
FT                   Protein of unknown function UPF0004; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55230"
FT                   /db_xref="GOA:B8I9H7"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H7"
FT                   /inference="protein motif:TFAM:TIGR01579"
FT                   /protein_id="ACL55230.1"
FT                   /translation="MPVEVLSFGCRLNTAEGEVLRRAAETGRPGEDLVVVNTCAVTAEA
FT                   TRQARKAIRGAARRTPGARIVVTGCGAQVETAAYAAMPEVAAIIGNHAKLSPAAWADRA
FT                   GGRVRVEDIMAVREAAAAPTPRMPGRTRAVLPVQNGCDHRCTFCVIPFGRGPSRSLPVQ
FT                   EAIAQARALVEDGAREVVLTGVDLTAYGRDLPEAPSLGGLVKAILRALPDLDRLRLSSI
FT                   DSVEADADLLDALASERRLMPHLHLSLQAGDDLILKRMKRRHARADAIAFCETVRRLRP
FT                   EIVFGADLIAGFPTETEAQFGRSVALVEECGLAHLHVFPYSPRPETPAARMPQLPAEII
FT                   RDRAARLRAAGEAALGRRLDREVGQVRAVLAERGGIGRTEGFLPVRLPDGVAPGTLRAV
FT                   AITGHDGRVLAAA"
     atgcccgtcg aggtgctgag cttcggctgc cggctcaaca cggccgaggg cgaggtcctg        60
     cgccgggcgg ccgagaccgg acggcccggg gaggatctcg tcgtcgtcaa cacctgcgcg       120
     gtcaccgcgg aggcgacgcg gcaggcacgc aaggcgattc gcggcgccgc gcgccgcacg       180
     cccggcgcgc ggatcgtggt gacgggctgc ggcgcacagg tcgagaccgc ggcctatgcg       240
     gccatgcccg aggtcgccgc catcatcggc aaccatgcca agctcagccc ggccgcctgg       300
     gcggatcgcg ccggagggcg ggtccgcgtc gaggacatca tggccgtgcg ggaggctgcc       360
     gcggcgccga cgccccggat gcccggtcgc acccgcgccg tccttccggt gcagaacggc       420
     tgcgatcacc gctgcacctt ctgcgtaatt ccgttcgggc ggggcccttc gcgctctctg       480
     ccggtgcagg aggccatcgc acaggcgcgc gcgctcgtcg aggacggcgc ccgggaggtg       540
     gttctcaccg gcgtcgacct caccgcctac gggcgggacc tgccggaagc cccgagcctc       600
     ggcgggctgg tgaaggcgat cctgcgcgcc ctgccggacc tcgaccgcct gcggctctcc       660
     tccatcgatt cggtcgaggc agatgcggat cttctcgacg ccctcgcgag cgagaggcga       720
     ctgatgccgc atctgcacct ctcgctgcag gcaggcgacg atctcatcct caagcggatg       780
     aagcgccgtc acgcgcgcgc agatgccatc gccttctgcg agaccgtgcg gcgcctgcgg       840
     ccggagatcg tgttcggcgc cgacctgatc gccggctttc cgaccgagac cgaagcgcag       900
     ttcggccgct cggtcgcgct cgtggaggaa tgcgggctcg cgcatctcca cgtcttcccc       960
     tactcccccc ggcccgaaac cccggccgcc cggatgccgc agcttcccgc agagatcatc      1020
     cgcgaccggg ccgcgcgcct gcgcgcggcc ggggaagcgg cgctcggccg ccgcctcgac      1080
     cgggaggtcg ggcaggtgcg ggcggtgctg gccgagcgcg gcggcatcgg ccgcaccgaa      1140
     gggttcctgc ccgtccggct gccggatggc gtcgcgcccg ggactttgcg cgctgttgcc      1200
     atcacggggc atgacggtcg ggtgctcgcg gcggcctga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page