(data stored in ACNUC7421 zone)

EMBL: CP001349.PE179

CP001349.PE179       Location/Qualifiers
FT   CDS_pept        complement(199716..200144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0186"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   met:M446_3654 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55231"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H8"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACL55231.1"
FT                   /translation="MDEGQGGTIFGAEIPFARLCGVEALRFENGRTHLRLVLGPEHANN
FT                   LGIAHGGVLCTLLDIAMGTVARLTAGRPVVTLDMQTRFLSPGRGVLLAEGRVVRAGQSI
FT                   LFCDAEVRGEAGTLVASASGVFKPTGLREPASRRPGES"
     atggatgaag ggcagggcgg gacgatcttt ggagcggaga ttccgttcgc gcggctctgc        60
     ggggtcgaag ccctgcgctt cgagaacggg cgcacgcatc tgcgcctggt tctggggccc       120
     gagcacgcca acaatctggg catcgcccat ggcggcgtgc tctgcacgct tctcgacatc       180
     gccatgggca cggtggcgcg gctcaccgcc gggcggcccg tggtgacgct cgacatgcag       240
     acgcgcttcc tgtcgccggg gcgtggcgtg ctcctggccg aggggcgggt cgtgcgcgct       300
     ggccaatcga tcctgttctg cgatgcggag gttcgtggcg aggccggaac gctggtggcg       360
     agcgcgagcg gcgtgttcaa gccgaccggg ctgcgggagc cggcgtcgcg ccggccgggc       420
     gagtcatga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page