(data stored in ACNUC7421 zone)

EMBL: CP001349.PE18

CP001349.PE18        Location/Qualifiers
FT   CDS_pept        complement(20817..21560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0019"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_0016
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55070"
FT                   /db_xref="GOA:B8IT08"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT08"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55070.1"
FT                   /translation="MSPRWSGALGTAAIGLLLAALAHPAVAGLVARAAGLSAGAPVPLD
FT                   RLLWLAQRHLFLALAGFALAGGLGLALGILATRTGGARLRGPIDALAAAAQAAPPVVVI
FT                   GLALPVLGFGAPPTLLALACYGLMPVLRATSDALGNVPEEVRAAAIAMGLTPAQLFWRV
FT                   DLPLAAGPILAALRVAMVVAVATAAVGALAGAPTLGTPIVVGLQNQNGLPLLQGAAAAA
FT                   ALAFLADAVVLAVEAVVRRPGQDPS"
     atgagcccgc gctggtccgg cgccctcggc actgccgcga tcgggctcct cctcgccgcc        60
     ctggcgcatc cggccgtcgc gggcctcgtc gcccgggcgg ccgggctgtc cgcgggcgcc       120
     cccgtgccgc tcgaccggct gctctggctc gcgcagcgcc acctgttcct tgcacttgcc       180
     ggcttcgcgc tcgccggcgg gctcggcctc gccctcggca tcctggcgac ccggacgggg       240
     ggcgcgcggc tgcgcggtcc gatcgacgcg ctcgccgccg ccgcccaggc cgccccgccc       300
     gtcgtggtga tcgggctcgc gctcccggtg ctcggtttcg gcgccccgcc gaccctgctg       360
     gcgctcgcct gctacgggct gatgccggtc ctgcgcgcca cgagcgatgc gctgggaaac       420
     gtgccggagg aggtgcgcgc cgccgcaatc gccatgggct tgacgcccgc gcagctgttc       480
     tggcgggtgg atctgccgct cgcggccggt ccgatcctcg cggccctgcg cgttgcgatg       540
     gtggtggcgg tggcgaccgc cgcggtcggg gcgctcgccg gcgcaccgac ccttggcacc       600
     ccgatcgtgg tcgggctgca gaaccagaac gggctgcctc tgctgcaggg cgcggcggcg       660
     gcggcggcgc tcgccttcct ggccgatgcg gtcgtgctcg cggtcgaggc cgtcgttcgg       720
     cgtccggggc aggatccgtc ctaa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page