(data stored in ACNUC7421 zone)

EMBL: CP001349.PE181

CP001349.PE181       Location/Qualifiers
FT   CDS_pept        complement(200928..203126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0188"
FT                   /product="malate synthase G"
FT                   /EC_number="2.3.3.9"
FT                   /note="TIGRFAM: malate synthase G; PFAM: malate synthase;
FT                   KEGG: met:M446_3652 malate synthase G"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55233"
FT                   /db_xref="GOA:B8I9I0"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I0"
FT                   /inference="protein motif:TFAM:TIGR01345"
FT                   /protein_id="ACL55233.1"
FT                   /translation="MDRQTVSGLKVARVLHDFVVREALPGTGVSPEVFWGGLAAILRDL
FT                   TPKNRALLAKRDALQDRIDAWHRERVGRPIDAAEYERFLREIGYLLPDPGPVKARTENV
FT                   DDEIATIAGPQLVVPVSNARYALNAANARWGSLYDAFYGTDAISEEGGATRGPGYNRTR
FT                   GARVVTRARAFLDRTVPLAGGRHADVVTYAVENGGLVGNMNTGETIPLARPEAFVGYRG
FT                   RASMPSALLLRHNGLHIEIVLDRTHRIGRFDASGVADILIESAISTIMDLEDSVAAVDA
FT                   DDKVEVYRNWLGLMNGTLSARFEKDGRVMERRLNPDRHYTAPNGGEVTVPGRSLMLVRN
FT                   VGHHMVTDAVLDAEGNEVPEGILDAAVTAMIAIHDLRNESGLRNSRKGSVYIVKPKMHG
FT                   PEEVAFAVELFGRVEAMLGLERNTLKMGIMDEERRTTVNLAACIKAADERVVFINTGFL
FT                   DRTGDEIHTAMEAGPVIRKNDMKATPWIKGYEENNVDVGLACGLLGRAQIGKGMWAAPD
FT                   AMADMLMQKGAHPKAGASTAWVPSPTAATLHALHYHETDVHARQEELARRPRSALAEIL
FT                   QIPLARSNFAPDDVQQEIDNNAQSILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRI
FT                   SSQHIANWLHHGVVSEEQVVETLKRMAKVVDRQNAGDPLYRPMAPAFDGPAFRAACDLV
FT                   FKGRVQPNGYTEWILHARRREAKAAGAPTEKAREGATA"
     atggatcgac agacggtcag cgggttgaag gtggcgcggg tgctccacga tttcgtggtc        60
     cgcgaggcgc tgccgggcac gggcgtatcg ccggaggtct tttggggcgg gctcgccgcc       120
     atcctgcgcg atctcacgcc gaagaaccgc gcgctgctcg ccaagcgcga cgccctgcag       180
     gaccgcatcg acgcgtggca ccgtgagcgg gtcggccggc cgatcgacgc cgccgaatat       240
     gagcgcttcc tgcgcgagat cggctacctg ctgcccgatc ccggccccgt gaaggcccgg       300
     accgagaatg tggacgacga gatcgccaca attgcgggtc cgcagctcgt ggtgccggtc       360
     tcgaacgccc gctacgcgct caacgccgcc aatgcccgct ggggatcgct ctacgacgcc       420
     ttctacggca cggacgcgat ttccgaggag ggcggcgcga cgcgcggccc gggctacaac       480
     cgcacccgcg gcgcccgcgt cgtcacccgc gcccgcgcct ttctcgaccg caccgttccg       540
     ctcgccggcg ggcgccacgc agacgtggtg acctacgcgg tcgagaatgg cggcctcgtc       600
     ggcaacatga ataccggcga gaccatcccc ctggcgcggc ccgaggcctt cgtgggctat       660
     cgcggccggg ccagcatgcc ctcggccctg cttctgcgcc acaacggcct gcatatcgag       720
     atcgtcctcg accgcacgca ccggatcggc cgcttcgacg cctcgggcgt cgccgacatc       780
     ctgatcgaat cggcgatctc gaccatcatg gacctggagg attcggtcgc cgcggtggat       840
     gccgacgaca aggtcgaggt ctatcgcaac tggctcggcc tgatgaacgg caccctctcg       900
     gcgcggttcg agaaggacgg gcgcgtgatg gagcgccgcc tcaatcccga ccgccactac       960
     accgcgccga acggcggcga agtgacggtg cccggccgca gcctgatgct ggtgcgcaat      1020
     gtcggccacc acatggtcac ggacgcggtc ctcgacgccg agggcaacga ggtgccggag      1080
     ggcatcctcg acgccgccgt gacggcgatg atcgcgatcc acgacctgcg caacgagtcg      1140
     ggcttacgca acagccgcaa gggctccgtc tacatcgtca agccgaagat gcatggcccc      1200
     gaggaggtcg ccttcgcggt cgagctcttc ggccgggtcg aggcgatgct cgggctcgag      1260
     cgcaacacgc tcaagatggg catcatggac gaggagcgcc gcaccacggt gaacctcgcc      1320
     gcctgcatca aggccgccga cgagcgggtg gtgttcatca acaccggctt cctcgaccgc      1380
     accggcgacg agatccacac cgcgatggag gcgggtccgg tcatccgcaa gaacgacatg      1440
     aaggcgacgc cctggatcaa gggctatgag gagaacaacg tcgatgtcgg cctcgcctgc      1500
     ggcctgctcg gccgggcgca gatcggcaag ggcatgtggg cggcacccga cgccatggcc      1560
     gacatgctga tgcagaaggg cgcgcacccg aaggccggtg ccagcacggc ctgggttccc      1620
     tcgccgacgg ccgccaccct gcacgcgctg cactatcacg agacggacgt gcacgcccgc      1680
     caggaggagc tggcgcgccg gccccgctcg gccctggccg agatcctgca gatcccgctc      1740
     gcgcgctcga acttcgcgcc cgacgacgtg cagcaggaga tcgacaacaa cgcccagagc      1800
     atcctcggct acgtggtgcg ctggatcgac cagggcgtcg gctgttccaa ggtgccggat      1860
     atccacgatg tcggcctgat ggaggatcgg gcgaccctgc gcatctcctc gcagcacatc      1920
     gccaactggc tccaccacgg cgtcgtcagc gaggagcagg tcgtggagac gctcaagcgc      1980
     atggcgaagg tggtggaccg gcagaatgcc ggcgatccgc tctatcggcc gatggctccc      2040
     gccttcgacg gcccggcctt ccgggctgcc tgcgacctcg tcttcaaggg ccgcgtccag      2100
     ccgaacggct acaccgaatg gattctgcac gcccggcgcc gcgaggccaa ggccgccgga      2160
     gcgccgaccg aaaaggcccg cgagggcgcg acggcctag                             2199
//

If you have problems or comments...

PBIL Back to PBIL home page