(data stored in ACNUC7421 zone)

EMBL: CP001349.PE182

CP001349.PE182       Location/Qualifiers
FT   CDS_pept        203447..204169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0189"
FT                   /product="putative periplasmic ligand-binding sensor
FT                   protein"
FT                   /note="KEGG: met:M446_3651 putative periplasmic
FT                   ligand-binding sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55234"
FT                   /db_xref="InterPro:IPR018648"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I1"
FT                   /inference="similar to AA sequence:KEGG:M446_3651"
FT                   /protein_id="ACL55234.1"
FT                   /translation="MNSEERDVINGIFQRLEQAAQQPRDADAERFIADKLRAQPYAPYA
FT                   MAQLIYVQEEAIKSLNQQLEQARAELQQGQGAGQGSGGGFFSSIFGGGSRQEPPRQSAW
FT                   GGQPGYGQQPPGYGPGGYPQQGGYGQPGYGQPGYAPQQGGPWGGQPAPQRSGFLASALP
FT                   MAAGAAGGMLLGSALANAFSGGHSQLGSLGAADLGGAAGAQNAGGEDFGAPLGGGADFQ
FT                   DASFDDGDGDSGGGDDWV"
     atgaacagcg aagaacgcga cgtcatcaac ggcattttcc agcgtctcga gcaggccgcg        60
     cagcagcccc gcgatgccga cgcggagcgc ttcatcgccg acaagctccg ggcgcagccc       120
     tacgcaccct acgcgatggc gcagctgatc tatgtccagg aagaggcgat caagagcctc       180
     aaccagcaac tcgaacaggc tcgcgccgag ctgcagcagg gtcagggcgc cggacagggg       240
     tcgggcggcg gcttcttctc cagcatcttc ggcggcggat cgcgacagga gccgccgcgg       300
     cagagcgcgt ggggcggtca gcccggctac gggcagcaac cgcccggcta cgggcccggc       360
     ggctatccgc agcagggcgg ctacggacag cccggatacg ggcagccggg ctacgcgccc       420
     cagcagggcg gcccgtgggg cggccagccc gcgcctcagc ggagcggctt tctggcttcg       480
     gccctgccga tggcggcggg cgccgcgggc ggcatgctgc tcggcagcgc gctggcgaat       540
     gccttcagcg gcgggcattc gcagctcggc agcctgggcg cggccgacct cggcggcgcg       600
     gctggcgcgc agaatgcggg cggcgaggat ttcggcgctc cgctcggcgg cggcgccgac       660
     ttccaggacg cctcgttcga tgacggggac ggggattcgg gcggcgggga cgattgggtc       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page