(data stored in ACNUC7421 zone)

EMBL: CP001349.PE183

CP001349.PE183       Location/Qualifiers
FT   CDS_pept        complement(204335..205126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0190"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   met:M446_3650 ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55235"
FT                   /db_xref="GOA:B8I9I2"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I2"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACL55235.1"
FT                   /translation="MRVGVWLAAGVAACATVAEASAQEAGRYGGGFIEFLMTGRDPGSV
FT                   ARPLRPAPVAADGTLIPREQGMAPAYATSLRSGDLVRASPMAAYEPTPPRTRMAALPQG
FT                   LPEDAAGIGRALDGRYRRQIVPYAGGQKPGTVVIDTTSRFLYLVQPGGQAIRYGIGVGR
FT                   PGFTWAGIKTITQKREWPDWTPPPEMLRRRPDLPRHMEGGPANPLGARALYLGSSLYRI
FT                   HGTNEPHTIGQSVSSGCIRMMNEDVIDLYERVPVGATVIVS"
     atgagagttg gtgtgtggct ggccgcgggc gttgcggcct gcgccacggt cgccgaagcg        60
     tccgcccagg aggccggccg gtacggcggc ggcttcatcg agttcctgat gaccggccga       120
     gatccgggca gcgtcgcccg tccgcttcgg ccggctcccg tggccgccga tggcacgctg       180
     atcccgcgcg agcaaggcat ggcgccggcc tatgcgacgt ccctgcgctc gggcgacctc       240
     gtgcgcgcgt cgccgatggc ggcctacgag cccacccctc cgcgcacccg tatggcggcc       300
     ctgccgcagg gcctgccgga ggacgccgcc gggatcggcc gtgcgctcga cggacgctat       360
     cggcgccaga tcgttcccta tgcgggcggc cagaagcccg ggaccgtggt gatcgatacc       420
     acctcgcgct tcctctatct ggtgcagccc ggcggtcagg cgatccggta cggcatcggc       480
     gtcgggcgtc ccggcttcac ctgggccggc atcaagacca tcacgcagaa gcgcgagtgg       540
     cccgactgga cgccgccgcc cgagatgctg cgccggcgcc ccgacctgcc ccgccacatg       600
     gagggcgggc ccgccaaccc gctgggtgcg cgtgcgctct atctcggctc ctcgctctac       660
     cgcatccacg gcaccaacga gccgcacacg atcgggcaat ccgtgtcgtc gggctgtatc       720
     cgcatgatga acgaggacgt gatcgacctc tacgagcggg ttccggtcgg cgccaccgtc       780
     atcgtcagct ag                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page