(data stored in ACNUC7421 zone)

EMBL: CP001349.PE184

CP001349.PE184       Location/Qualifiers
FT   CDS_pept        205381..206091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0191"
FT                   /product="putative chemotaxis phosphatase, CheZ"
FT                   /note="KEGG: met:M446_3649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55236"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I3"
FT                   /inference="similar to AA sequence:KEGG:M446_3649"
FT                   /protein_id="ACL55236.1"
FT                   /translation="MKNKRFRIEDSLGAPPLPVAPAPAPEPDERISEILATVNELKRLT
FT                   QTTTGDMIEACRREIGEIYGLKAELDLMKEAINRTKTEIAALYRKDNDGKGVRRAAGEL
FT                   DAVVEATERATTTILAAVEDIETHAAVIRSTGNLKDHSSVDAILERTVMLYEACNFQDL
FT                   TGQRISKIVSVLKFVEEHIDRMIDAWGGLDAFKDMIGASMETGPFDESSLLNGPKLDED
FT                   PGHVDQADIDALFN"
     atgaagaaca agcgcttccg catcgaagac agtctcggcg cccctcccct gccggtcgcg        60
     ccggcgccag ccccagaacc cgacgagcgc atcagcgaaa tcctggcgac ggtcaacgaa       120
     ctcaagcggc tgacccaaac cacgaccggc gacatgatcg aggcgtgccg gcgggagatt       180
     ggagagatct acggtctcaa ggccgagctc gacctgatga aggaggcgat caaccggacg       240
     aagaccgaga tcgctgccct ctaccgcaag gacaatgacg gaaagggcgt gcggcgcgcg       300
     gcaggcgagc tcgacgcggt ggtcgaggcc accgagcgcg cgaccacgac gatcctcgcg       360
     gcggtcgagg acatcgagac ccatgccgcg gtgattcggt ccacgggcaa tctgaaagac       420
     cacagcagcg tcgatgcgat cctggagcgg accgtgatgc tgtacgaggc ctgcaacttc       480
     caggacctga ccggtcagcg catcagcaag atcgtcagcg tgctgaagtt cgtcgaggaa       540
     catatcgacc ggatgatcga tgcctggggc ggtctcgacg cgttcaagga catgatcggg       600
     gcatcgatgg aaacgggccc gttcgacgag agcagcctgc tcaatgggcc caagctcgac       660
     gaggatccgg gccatgtcga tcaggcggat atcgacgccc tcttcaactg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page