(data stored in ACNUC7421 zone)

EMBL: CP001349.PE185

CP001349.PE185       Location/Qualifiers
FT   CDS_pept        complement(212089..212763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0192"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: mlo:mll0909 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55237"
FT                   /db_xref="GOA:B8I9I4"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I4"
FT                   /inference="protein motif:PFAM:PF04140"
FT                   /protein_id="ACL55237.1"
FT                   /translation="MMRMALHTLVGTVLLGLVLFGPAGTLAWPEGWWFLALFIGCGVAI
FT                   GIWLALTDPGLLAARMASPFSADQAPRDRVVMALIALAFSVWLPAMALDARRFGWSHAP
FT                   LWTQVLGAVLVLAAFAGWVWVLRTNSFAAVTVRVQTERGQTVVSTGPYAFVRHPMYAFA
FT                   LLMLVGTPLLLGSLWGLAGLVLFVPLLAARALSEEAVLTEGLDGYRDYVRRVRYRLLPG
FT                   IW"
     atgatgcgga tggcgctgca cacgctggtt ggaaccgtcc ttctcggtct cgtcctgttc        60
     gggcccgcgg gcacgctggc atggcctgaa ggctggtggt tcctggcgct gttcatcggc       120
     tgcggcgtcg ccatcggcat ctggctggcg ctcaccgacc cggggctgct cgcggcccgc       180
     atggcctcgc ccttcagcgc cgaccaggcc ccgcgcgacc gggtcgtgat ggcgttgatc       240
     gcgctggcgt tctcagtctg gctgcccgcc atggcgctcg atgcgcgccg gttcggctgg       300
     tctcacgcgc cgctctggac gcaggtcctg ggcgcagtgc tggtcctcgc cgccttcgcg       360
     ggttgggtct gggttctgcg caccaacagc ttcgccgccg tgacggtgcg ggtgcagacc       420
     gagcgcgggc agaccgtcgt ctccaccggc ccctacgcct tcgtgcgcca cccgatgtat       480
     gccttcgccc tcctgatgct ggtcgggacg ccgctcctgc tgggctccct ctggggcctt       540
     gccgggttgg tgctgttcgt ccccttgctg gcggcccgcg cgctgagcga ggaagccgtg       600
     ctgacggagg gcctggacgg gtatcgcgac tatgtccgca gggtccgcta ccgcctgttg       660
     cccgggatct ggtga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page