(data stored in ACNUC7421 zone)

EMBL: CP001349.PE186

CP001349.PE186       Location/Qualifiers
FT   CDS_pept        213151..214866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0193"
FT                   /product="potassium-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="TIGRFAM: potassium-transporting ATPase, A subunit;
FT                   PFAM: K transporting ATPase A subunit; KEGG:
FT                   mrd:Mrad2831_0209 potassium-transporting ATPase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55238"
FT                   /db_xref="GOA:B8I9I5"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I9I5"
FT                   /inference="protein motif:TFAM:TIGR00680"
FT                   /protein_id="ACL55238.1"
FT                   /translation="MTLNGWTQITLYGAVVLALVKPLGWYMTRVFTGERTLLSPVLAPI
FT                   ERGLYRAAGIDARQEQTWLGYAGALLLFHVFGFLVLYAILRLQAALPLNPADQAAVAPD
FT                   LAFNTSASFITNTNWQNYGGESTLSYLSQMLGLTHQNFLSAATGIAVAVALIRGFARAS
FT                   TRTLGSFWVDLTRAILYVLLPICILYTLFLVWQGIPQTLGAYIDATTLEGGKQTIALGP
FT                   VASQVAIKMLGTNGGGFFNANAAHPFENPTALSNFVQMVSIFAIGAALTNVFGRMVGDE
FT                   RQGWAILAAMGALFLAGVAVAYWAEANGSPVLASFGLSGGNLEGKEVRFDIAASALFAV
FT                   VTTAASCGAVNAMHDSFTALGGMIPLVNMQLGEVIIGGVGAGLYGMLIFVVVAIFVAGL
FT                   MVGRTPEYLGKKIETKEVKMAMLGILCLPLMMLGFTALATVLPTGLAGPANAGPHGFSE
FT                   ILYAYTSAAANNGSAFAGLSGNTPFYNATLAVGMLVGRFFVIIPALAIAGALAAKKTVP
FT                   ASAGTFPTDGALFVGLLVGVILIIGGLTFFPALALGPVVEHLAGAAGQTFAMGD"
     atgaccctca acggctggac ccagatcacg ctctatggcg cggtcgtgct ggcgctcgtc        60
     aaaccgctcg gctggtacat gacgcgcgtc ttcaccggcg aacggaccct gctgtctccc       120
     gtgctcgcgc ccatcgagcg cgggctctac cgcgcagcgg gcatcgacgc acgccaggag       180
     cagacctggc tcggctatgc cggcgcgctg ctcctcttcc acgtcttcgg cttcctggtg       240
     ctctacgcca tcctgcgcct gcaggcggcg ttgcccctca atccggcgga tcaggcggcg       300
     gtggcaccgg atctcgcctt caacacctcg gcgagcttca tcaccaacac caactggcag       360
     aactacgggg gcgagagcac gctctcctac ctgtcccaga tgctggggct tacccaccag       420
     aacttcctct cggcggccac cggcatcgcg gtggcggtcg cgctgatccg aggcttcgcc       480
     cgggcctcga cccggacgct cggctcgttc tgggtcgacc tgacccgggc catcctctac       540
     gtgcttctgc cgatctgcat tctctacacg ctgttcctgg tctggcaggg catcccgcag       600
     acgctcgggg cctatatcga cgccactacg ctcgaaggcg gcaagcagac gatcgcgctc       660
     gggccggtcg ccagccaggt ggcgatcaag atgctcggca ccaacggcgg cggcttcttc       720
     aacgccaacg cggcgcaccc gttcgagaac ccgaccgccc tgtcgaactt cgtccagatg       780
     gtctcgatct tcgccatcgg ggcggcgctc accaacgtgt tcggccgcat ggtcggcgac       840
     gagcgccagg gctgggcgat cctcgccgcc atgggcgcgc tgttcctcgc cggcgtggcc       900
     gtggcctatt gggccgaggc caacggcagc ccggtcctcg cctccttcgg cctttccggc       960
     ggcaacctgg agggcaagga ggtccgcttc gacatcgcgg cctcggcgct gttcgcggtc      1020
     gtcaccacgg ccgcctcctg cggcgccgtg aatgccatgc acgacagctt cacggcgctc      1080
     ggcggcatga tcccgctcgt caacatgcag ctcggcgagg tgatcatcgg cggcgtgggc      1140
     gccggcctct acggcatgct gatcttcgtc gtcgtggcga tcttcgtcgc cgggctgatg      1200
     gtcggccgca cccccgaata cctcggcaag aagatcgaga cgaaggaggt caagatggcc      1260
     atgctcggca tcctgtgcct gccgctgatg atgctgggct tcacggcgct tgccaccgtc      1320
     ctgccgaccg ggctcgcggg tccggccaat gcgggcccgc acggcttctc ggagatcctc      1380
     tacgcctata cctcggcggc ggccaataac ggctcggcct tcgcgggcct ctcgggcaac      1440
     acgccgttct acaacgcgac gctcgcggtc ggcatgctgg tcgggcggtt cttcgtgatc      1500
     atcccggcgc tggcgatcgc cggcgcgctg gccgccaaga agacggttcc ggcctcggcc      1560
     ggcaccttcc cgaccgatgg cgcgctgttc gtcggcctgc tcgtcggggt gatcctgatc      1620
     atcggcggcc tgaccttctt cccggccctg gcgctcggcc cggtcgtcga gcatctcgcc      1680
     ggcgcggccg gccagacctt cgcgatggga gactga                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page