(data stored in ACNUC7421 zone)

EMBL: CP001349.PE187

CP001349.PE187       Location/Qualifiers
FT   CDS_pept        214868..215110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55239"
FT                   /db_xref="GOA:B8I9I6"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55239.1"
FT                   /translation="MCDTGSLRVAQRRAALRPGASRRRGLALHRPRPPVWSRMSPTREG
FT                   PRASDLVLAMLGVTLLGGLALMASIDLLGRGLAQH"
     atgtgcgaca ccggttccct gagggtcgcg cagaggcgcg cggccttgcg cccgggtgcc        60
     tcccggcgcc ggggtctcgc cctccacagg ccccgccctc cggtctggag ccgcatgtcc       120
     ccgacacggg aaggcccgag ggcatccgac ctcgtcctcg ccatgcttgg cgtgaccctg       180
     ctcgggggct tggccctgat ggcttccatc gacctcctcg gtcgcggcct cgcgcagcac       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page