(data stored in ACNUC7421 zone)

EMBL: CP001349.PE188

CP001349.PE188       Location/Qualifiers
FT   CDS_pept        215171..217276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0195"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; K+-transporting ATPase, B
FT                   subunit; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   mrd:Mrad2831_0207 K+-transporting ATPase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55240"
FT                   /db_xref="GOA:B8I9I7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I7"
FT                   /inference="protein motif:TFAM:TIGR01497"
FT                   /protein_id="ACL55240.1"
FT                   /translation="MARQISSLFSAALIGPALIGAVRKLDPRILIRNPVMFVVEVVAAL
FT                   TTVLFVRDVLTGGADLAFTGQIILWLWFTVLFANFAEAIAEGRGKAQADALRRTRTEMT
FT                   AKLLTGPAASVGGPRSGFRVVPGTTLRVGDVVLVEAGDLIPSDGEVIEGVASVNEAAIT
FT                   GESAPVIRESGGDRSAVTGGTQVLSDWIRVRITAAAGSTFVDRMIALVEGAARQKTPNE
FT                   IALNILLAGLTIIFVIAVATIPSFAAYAGGAIPMVVLVALFVTLIPTTIGALLSAIGIA
FT                   GMDRLVRFNVLAMSGRAVEAAGDVDTLLLDKTGTITLGNRQAAEFRPLRGVTEQELADA
FT                   AQLASLADETPEGRSIVVLTKERYGIRARDMASLHATFVPFTAQSRMSGVDLDGSSIRK
FT                   GAVDAILAHVTASATAVVPSGAIRVMQPQVSAAAVREVQAITEEIAKAGGTPLAVARGG
FT                   RLLGVVHLKDIVKGGIRERFAELRRMGIRTVMITGDNPVTAAAIAAEAGVDDFLAQATP
FT                   EDKLALIRKEQQQGKLVAMCGDGTNDAPALAQADVGVAMNTGTVAAREAGNMVDLDSDP
FT                   TKLIEIVEIGKQLLMTRGALTTFSIANDVAKYFAIIPAMFVTLYPQLQALNVMGLASPQ
FT                   SAILSAIIFNALIIVALIPLALKGVRYRAVGAAALLRRNLMIYGLGGILVPFAGIKLID
FT                   LAVSALL"
     atggcccgcc agatctcgtc cctgttcagc gccgccctga tcgggcccgc gctcatcggc        60
     gcggtgcgca agctcgaccc gcgcatcctc atcaggaatc ccgtcatgtt cgtggtcgag       120
     gtggtcgccg cgctcacgac cgtcctgttc gtgcgcgacg tcctcacagg aggcgccgac       180
     ctcgccttca cgggccagat catcctctgg ctgtggttca ccgtgctgtt cgccaacttc       240
     gccgaggcca tcgcggaggg gcgcggcaag gcccaggccg atgccttgcg gcgcacccgc       300
     accgagatga cggcaaagct cctcaccggc cccgccgctt cggtcggcgg cccccggagc       360
     ggcttccgcg tggtgccggg caccaccctg agggtcggcg acgtggtgct ggtcgaggcc       420
     ggcgacctga tcccctccga cggcgaggtc atcgagggcg tggcctcggt gaacgaggcg       480
     gcaatcaccg gcgaatccgc ccccgtgatc cgcgaatccg gcggcgaccg ctcggcggtc       540
     accggcggca cgcaggtgct ctcggattgg atccgggtgc gtatcacggc ggcggcgggc       600
     tcgaccttcg tcgaccgcat gatcgccctg gtcgagggcg cggcgcgcca gaagaccccg       660
     aacgagatcg cgctcaacat cctgctcgcc ggcctcacga tcatcttcgt catcgcggtg       720
     gcgacgatcc cgagcttcgc tgcttacgcg ggcggcgcca tcccgatggt ggtgctggtg       780
     gcgctgttcg tgaccctgat cccgaccacg atcggggcgc tgctctcggc catcggcatc       840
     gcgggcatgg accggctggt gcgcttcaac gtgctcgcca tgtcgggccg cgccgtcgag       900
     gcggcgggcg acgtcgacac cttgctcctc gacaagaccg gcacgatcac gctgggcaac       960
     cgccaggcgg cggagttccg cccgctgcgc ggcgtcaccg aacaggagct ggcggatgcg      1020
     gcccagctcg cctcgctggc cgacgagacg ccggagggcc gctcgatcgt ggtgctgacc      1080
     aaggagaggt acgggatccg cgcccgcgac atggcgagcc tccacgccac cttcgtgccg      1140
     ttcacggcgc agtcgcgcat gtcgggcgtc gacctcgacg gatcctcgat ccgcaagggc      1200
     gccgtcgatg cgatcctcgc gcacgtgacc gcctccgcca ccgccgtagt gccgagcggc      1260
     gcgatccggg tgatgcagcc ccaggtctcg gctgccgccg tccgcgaggt ccaggccatc      1320
     accgaggaga tcgcgaaggc gggcggcacg ccgctcgcgg tggcccgcgg cgggcgcctg      1380
     ctcggggtgg tccacctcaa ggacatcgtg aagggcggca tccgcgaacg cttcgcggag      1440
     ctgcgccgca tgggcatccg caccgtgatg atcaccggcg acaatccggt gaccgcggcg      1500
     gccatcgcgg cggaggccgg cgtcgacgac ttcctcgccc aggccacccc cgaggacaag      1560
     ctcgccctca tccgcaagga gcaacagcag ggcaagctgg tggccatgtg cggcgatggc      1620
     accaacgacg cgccggcgct cgcccaggcg gatgtcggtg tcgccatgaa taccggcacg      1680
     gtcgccgccc gcgaggcggg caacatggtc gacctcgatt ccgacccgac caagctcatc      1740
     gagatcgtcg agatcggcaa gcagctgctg atgacccgcg gcgcgctcac caccttctcg      1800
     atcgccaacg acgtggcgaa gtatttcgcc atcatcccgg cgatgttcgt gacgctctac      1860
     ccgcagctgc aggcgctcaa cgtgatgggg ctggcctcgc cgcagagcgc gatcctctcg      1920
     gcgatcatct tcaacgcgct gatcatcgtc gcgttgatcc cgctggcact caagggcgtg      1980
     cgctaccggg cggtcggcgc cgccgcgctg ctgcggcgca acctcatgat ctacggcttg      2040
     gggggcatcc tggtgccctt cgccggcatc aagctcatcg acctcgcggt cagtgccctg      2100
     ctctag                                                                 2106
//

If you have problems or comments...

PBIL Back to PBIL home page