(data stored in ACNUC7421 zone)

EMBL: CP001349.PE189

CP001349.PE189       Location/Qualifiers
FT   CDS_pept        217354..217959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0196"
FT                   /product="potassium-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="TIGRFAM: potassium-transporting ATPase, C subunit;
FT                   PFAM: K transporting ATPase KdpC subunit; KEGG:
FT                   mrd:Mrad2831_0206 potassium-transporting ATPase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55241"
FT                   /db_xref="GOA:B8I9I8"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I9I8"
FT                   /inference="protein motif:TFAM:TIGR00681"
FT                   /protein_id="ACL55241.1"
FT                   /translation="MLQHLRPTLVLGVALTLLTGLAYPLAMTGLAGILFPVEAAGSLVE
FT                   RDGKVVGSRLIGQSFTGDRFFHGRPSATTAPDPTDASKTMPAPYNAANSGGSNLGPTSA
FT                   ALADRVKADVERLRAENPGAPVPVDLVTTSGSGLDPDISPEAALFQVPRIAKARHLPEE
FT                   RLRDLVAAQVQGRTLGLIGEPRVNVLALNLALDELAGK"
     atgctccagc atctgcgccc caccctggtc ctgggggtcg ccctgaccct gctcacgggc        60
     ctcgcctacc cgctcgcgat gaccggcctc gccgggatcc tcttcccggt agaggccgcc       120
     ggcagcctcg tcgagcgtga cggcaaggtg gtcggctcca ggctcatcgg tcagagcttc       180
     accggcgacc gcttcttcca cggccggccc tcggcgacca cggcgccgga ccccaccgac       240
     gcctccaaga ccatgccggc gccctacaac gcggcgaatt cgggcggctc caacctcggt       300
     ccgaccagcg cggccctggc cgaccgggtc aaggccgatg tcgagcggct ccgggccgag       360
     aatccgggcg cgcccgtgcc ggtggacctc gtgaccacca gcggctcggg cctcgacccg       420
     gacatttcgc ccgaagccgc gctgttccag gtgccccgca tcgccaaggc gcgccatctt       480
     cccgaggagc gcctgcgcga cctcgtggcc gcgcaggtcc agggccggac cctcggcctc       540
     atcggcgagc cgcgcgtgaa cgtgctcgcg ctcaatctcg ccctcgacga gcttgccggg       600
     aaatag                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page