(data stored in ACNUC7421 zone)

EMBL: CP001349.PE19

CP001349.PE19        Location/Qualifiers
FT   CDS_pept        complement(21557..22696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0020"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_0017
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55071"
FT                   /db_xref="GOA:B8IT09"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT09"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55071.1"
FT                   /translation="MTLGARPLPVLAFAAAATAAAALAGLPLLTLAPNRLVPGAPVGAG
FT                   WAGAGAALLGLLAAGLLSGTRRRDALLALAAALTGLAVLGLGIGAGAAGLLAGQPPAAR
FT                   ASLGAGAWIAGLALALIAGEAVRATALQAAGLLTLAISVLAGGIAVHSGLFDSLSLVVE
FT                   YRARAGAVNAAILQHLALAAGALALAVAASVPLALLSLRRGFAARLIDTALNGVQVVPA
FT                   LALFAALVSLLSGLLARLPGLRELGLGAIGPTPAVIGTAAYLALPLVRSLAAGLAATDP
FT                   TVVETARALGLTPWQVLLRVRLPLGAPILLGGLRVAAVQSIGLTTLGGLVGAGGLGAVV
FT                   FDGMAQFAPDLIVLGAVPVIALSLAVDRGLAALNPRRVA"
     atgacgctcg gcgcccgccc gctcccggtc ctcgccttcg cggccgccgc gaccgccgcg        60
     gcggcgctcg ccggtctgcc gctcctgacc ctggcgccga accggctcgt cccgggtgca       120
     ccggtcgggg ccggctgggc gggggccggc gcggccctgc tcggcctgct cgccgcggga       180
     ttgctgtccg gcacgcgccg ccgcgatgcg ctcctggcgc tcgccgccgc cctcacgggg       240
     ctcgcagtgc tgggcctcgg catcggggcg ggagcggccg ggctcctcgc cgggcagcca       300
     ccggccgcgc gggcctccct cggcgcgggg gcgtggatcg ccgggctcgc gctcgcgctg       360
     atcgcgggcg aagcggtccg ggccaccgcc ctccaggccg ccgggctctt gacgctcgcg       420
     atctccgtcc tggctggcgg gatcgcggtc cattccggat tgttcgactc cctctcgctg       480
     gtggtggagt accgcgcccg cgccggggcg gtgaatgccg ccatcctcca gcacctcgcg       540
     ctcgccgctg gcgcactggc gctcgccgtt gcggcgagcg tgccgcttgc gcttctgagc       600
     ctgcgccgag ggttcgcggc gcgcctgatc gacacggcgc tcaacggcgt tcaggtcgtg       660
     ccggcactgg cgctcttcgc cgctttggtc tccctgctgt cgggcctgct cgcgcggctg       720
     cccgggctgc gggaactcgg cctcggggcg atcgggccga ccccggccgt gatcggcacc       780
     gccgcctacc tcgccctgcc gctcgtccgg agcctcgcgg cgggccttgc cgcgacggat       840
     cccaccgtcg tcgagaccgc gcgcgccctc ggcctgacgc cgtggcaggt cctgctgcgg       900
     gtgcggctcc cgctcggcgc cccgatcctc ctcgggggcc tcagggtcgc ggcggtgcag       960
     agcatcgggc tgacgacgct cggcggcctc gtcggcgcgg gcgggctcgg ggcggtggtc      1020
     ttcgacggga tggcgcagtt cgccccggac ctgatcgtgc tcggcgccgt gccggtgatc      1080
     gccttgtcgc tcgccgtcga tcgcggcctc gccgcactca acccccggag ggtcgcatga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page