(data stored in ACNUC7421 zone)

EMBL: CP001349.PE190

CP001349.PE190       Location/Qualifiers
FT   CDS_pept        217982..220705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0197"
FT                   /product="osmosensitive K+ channel signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; Osmosensitive K channel
FT                   His kinase sensor; UspA domain protein; KEGG:
FT                   mrd:Mrad2831_0205 osmosensitive K+ channel signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55242"
FT                   /db_xref="GOA:B8I9I9"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I9"
FT                   /inference="protein motif:PFAM:PF02702"
FT                   /protein_id="ACL55242.1"
FT                   /translation="MSEPRRDPTRPSPDALLAAARREEGRRGRLKVFLGAAPGVGKTYE
FT                   MLTIGRARRKAGADVVVGIVETHGRAETEVLLEGFEVIPRRRVPYRGTLLEEMDLDALL
FT                   ARRPALALVDELAHTNAPGSRHPKRYQDVEELLDAGIDVLTTLNIQHVESLNDVVASIT
FT                   RIRVRETVPDSILDRADDIEVVDLNPDDLIQRLKDGKVYVPQNAERALKHYFSRGNLTA
FT                   LRELALRCTADRVDDELLSHMRANAIAGPWGAGERVLVCVGEDPRAAGLVRYAKRLADR
FT                   LHAPWTALTVEGPRSPSLSEAERDRIADTLRLADRLGGDTVTIPGGRRIAEDILAYARS
FT                   ANVNHVVVGKSDRSWLFELMHGSVVHDLVRRSGTISVHVVAGEAAEAAPVPRKTVATMA
FT                   ATPAWGPRPYAVALLAVAAALGVALLGQPYVGVENSNLFLLSSVVAVAVRYGLGPSLLA
FT                   VVAASLSYNFFFLPPVYTFTIADPTNVAAFVLFTVVAVLVSNLAARSQRVAAVAQARAR
FT                   ATERLYGFSRKLASCGTLDDVLWATCAQVAAMLKVRVVLLLPEQDGLAVRAGYPPEDML
FT                   DDADVAAAKWAFDNDRSAGRGADTLPGAKRLFLPMRTGRGTIGVIGLDADGTGPILTPE
FT                   GRRLLDALADQGALAIERVRLVEDLDRAERAAETDRLRQALLTSMSHDLRTPLASVLGA
FT                   ATTLRDLDEALAPEAKRDLLATIIAESERLNRFIANLLDMTRLEAGAVAPNLAPHDIGE
FT                   TVGTALRRTEAMLAGHRVAIDVPADLPALRLDPVLFEQVLVNLLDNAAKYAPEGSTVTI
FT                   RGWREGSLVRLQVLDEGEGLPEAEIERVFDKFYRVRKGDRVRAGTGLGLSIARGFVEAM
FT                   GGALVAANRPDRPGAAFTLTLPVPAKDRDAAPEIAA"
     atgtccgaac cacgccgaga tccgacccgc ccctcgcccg atgcgctgct cgccgccgcc        60
     cgccgggagg agggccggcg cgggcgcctc aaggtgttcc tcggtgcggc gcccggcgtc       120
     ggcaagacct acgagatgct caccatcggg cgggcccggc ggaaggccgg cgccgacgtg       180
     gtggtgggga tcgtcgagac ccacggccgg gccgagaccg aggtgctgct ggagggcttc       240
     gaggtgatcc cccgccgccg cgtgccctat cgcggcacgc tgctggagga gatggatctc       300
     gacgcgctcc tcgcccgccg cccggctctc gccctggtgg acgagctcgc ccacaccaac       360
     gccccgggct cgcgccaccc gaagcgctac caggacgtcg aagagctgct cgatgccggc       420
     atcgacgttt tgaccaccct caatatccag catgtcgaga gcctcaacga cgtggtggcc       480
     tccatcaccc gcatccgcgt acgcgagacc gtgccggatt cgatcctcga ccgggccgac       540
     gacatcgagg tggtcgacct caacccggac gacctgatcc agcggctcaa ggacggcaag       600
     gtctacgtgc cgcagaacgc cgagcgggcg ctcaagcact acttctcgcg cgggaacctg       660
     acggctttgc gcgaactcgc cctgcggtgc acggccgacc gggtcgatga cgagctcctc       720
     agccatatgc gggcgaatgc catcgccggg ccatggggcg ccggcgagcg cgtgctggtc       780
     tgcgtcggcg aggatccgcg cgcggccggg ctcgtgcgct atgccaagcg cctcgccgac       840
     cggctgcacg cgccctggac cgcgctcacc gtcgaggggc cgcgcagccc gtccctgagc       900
     gaggccgagc gcgaccgcat cgccgacacc ctgcggctgg ccgaccggct cggcggcgat       960
     accgtcacca tcccgggcgg gcggcgcatt gccgaggaca tcctcgccta tgcgcgttcg      1020
     gccaatgtca accacgtcgt ggtcggcaag tccgatcgct cgtggctgtt cgagctcatg      1080
     cacggctcgg tggtgcacga cctcgtgcgc cggagcggca ccatcagcgt ccacgtcgtg      1140
     gccggcgagg ccgcagaggc agcaccggtg ccgcgcaaga ccgtggccac catggcggcc      1200
     acgccggcct gggggccgcg cccctatgcg gtcgccctct tggcggtcgc ggcggccctc      1260
     ggcgtggccc tcctcggcca gccctatgtc ggggtcgaga attccaacct gttcctgctc      1320
     tcctcggtgg tcgcggtggc ggtgcggtac gggctcggcc cgtcgctgct cgcggtcgtc      1380
     gccgcctcgc tgtcctacaa cttcttcttc ctgcccccgg tctacacctt caccatcgcc      1440
     gacccgacga acgtggcggc cttcgtgctg ttcacggtgg tggcggtgct ggtctcgaac      1500
     ctcgccgccc gctcgcagcg tgtcgccgcc gtcgctcagg cgcgcgcgcg agcgaccgag      1560
     cgcctctacg gcttctcccg caagctcgcg agctgcggca ccctcgacga cgtgctctgg      1620
     gcgacctgcg cgcaggtggc ggcgatgctc aaggtgcggg tcgtgctgct cctgcccgag      1680
     caggacgggc tggcggtgcg ggccggctac ccgccggagg acatgctcga cgacgccgat      1740
     gtggcggccg ccaagtgggc cttcgacaac gaccggtccg cgggccgggg agccgacacc      1800
     ctgccgggcg ccaagcgtct gttcctgccg atgcggacgg gccgcggcac catcggggtg      1860
     atcgggctcg atgccgacgg caccggcccg atcctcacgc cggaaggccg gcgcctgctc      1920
     gacgcgctcg ccgaccaggg ggcactcgcc atcgagcggg ttcgcctcgt cgaggacctc      1980
     gaccgggccg agcgggccgc cgagacggac cggctgcgtc aggcgctgct cacctcgatg      2040
     tcccacgacc tgcgcacccc gctcgcctcg gtgctgggcg ccgccaccac cctgcgcgac      2100
     ctcgacgagg cgctggcccc cgaggccaag cgggacctgc tggcgacgat catcgcggaa      2160
     tccgagcggc tgaaccgctt catcgccaat ctcctcgaca tgacccggct cgaggccggc      2220
     gcggtcgcgc ccaacctcgc cccgcacgac atcggcgaga cggtcggcac cgcgctgcgc      2280
     cgcaccgagg caatgctggc cgggcaccgc gtcgcgatcg acgtgccggc cgaccttccg      2340
     gccctgcggc tcgacccggt gctgttcgag caggtgctgg tgaacctgct cgacaacgcc      2400
     gcgaaatacg cacccgaggg ctccacggtg accatccgcg ggtggcggga ggggagcctc      2460
     gtgcgcctcc aggtgctcga cgagggcgag ggcctgcccg aggccgagat cgagcgggtg      2520
     ttcgacaagt tctaccgcgt ccgcaagggc gaccgggtcc gggccgggac cgggctcggg      2580
     ctgtccatcg cccgtggctt cgtcgaggcg atgggcggcg ccctcgtcgc cgcgaaccgc      2640
     cccgaccgcc cgggagccgc cttcaccctg acgctgccgg tcccggcaaa ggaccgggac      2700
     gccgctccgg agatcgccgc atga                                             2724
//

If you have problems or comments...

PBIL Back to PBIL home page