(data stored in ACNUC7421 zone)

EMBL: CP001349.PE192

CP001349.PE192       Location/Qualifiers
FT   CDS_pept        220890..221360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0199"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: mrd:Mrad2831_0203
FT                   putative PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55244"
FT                   /db_xref="GOA:B8I9J1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J1"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ACL55244.1"
FT                   /translation="MTLEDLLSPDQAVTGLRVGGKDALLEEMARRAGRATGLGMDAILS
FT                   ALVKREALGSTGVGDGVALPHGRLAGLARPFGLLASLRAAIAYEAVDDRPVDLVVLLLL
FT                   PRNAEGADLNALACVARRLRDRRVADAMRAARDAAQLYAAACGAGSLTRSGA"
     atgaccctcg aagatctgct gtcgccggac caggccgtca caggccttcg ggtcggcgga        60
     aaggacgccc tcctggagga gatggcccgc cgcgccggac gcgccaccgg gctcggcatg       120
     gatgccatcc tgtcggcgct ggtgaagcgc gaggcgctcg gttcgaccgg ggtcggggac       180
     ggcgtcgccc tgccgcatgg ccggctggcc gggctcgccc gccccttcgg cctgctggcg       240
     agcctgcggg ccgccatcgc ctacgaggcg gtcgacgacc ggcccgtcga cctcgtcgtc       300
     ctgctgcttc tgccaaggaa cgcggagggc gcggacctga acgccctggc ctgcgtggcg       360
     cgccggctgc gcgacaggcg ggtggccgat gcgatgcgcg cggcccgcga cgcggcgcag       420
     ctctatgccg cggcctgcgg ggccggatcg ctcacgcgat ccggagcgtg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page