(data stored in ACNUC7421 zone)

EMBL: CP001349.PE193

CP001349.PE193       Location/Qualifiers
FT   CDS_pept        complement(221341..222123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0200"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rle:pRL120704 putative hydratase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55245"
FT                   /db_xref="GOA:B8I9J2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J2"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ACL55245.1"
FT                   /translation="MPLAPSETEALGWDLAMARRTGQISTNADLRRLSDLDDAEAVLAA
FT                   ALRHLGGAPAGYVLTGTSPPCAKLLCCEHPVVAPLVREGLLEEGGSLHLPGGAIGVGAG
FT                   FAFRLGRPFPDDGEEITEERAAEACVSCHLDLHLLGRRMPNGILLNAWTATADFGLDVA
FT                   RIRGPRVAGWHDGDLREAAVSLRVDGNELARGRGADILGSPIAAVAWLAGYLAERDLCL
FT                   NAGDLVATGSCTGLIQVLPGQTVLAEFGPLGRVTLRIA"
     atgccactcg ccccttccga gaccgaggcc ctgggctggg acctggccat ggcgcgccgc        60
     accgggcaga tctcgaccaa cgccgacctg cggcgcctgt ccgacctcga cgacgccgag       120
     gccgtgctgg cggcggcgct gcgccacctc ggcggcgccc cggccggcta cgtgctgacc       180
     gggacgagcc ctccctgcgc caagctcctg tgctgcgagc acccggtcgt cgccccgctc       240
     gtgcgcgaag ggctcctgga ggaaggaggg agcctgcacc tgccgggagg cgccatcggg       300
     gtgggggccg gcttcgcgtt ccggctcggg cggccattcc cggacgatgg cgaggagatc       360
     acggaggagc gggcggcgga ggcctgtgtc tcctgccatc tcgacctgca cctcctcggc       420
     cgccgcatgc cgaacggcat cctcctcaac gcctggaccg ccaccgccga tttcggcctc       480
     gacgtcgcgc gtatccgcgg gcctcgggtc gcgggctggc acgacgggga cctgagggag       540
     gccgcggtgt cgcttcgcgt cgacggcaac gaactcgccc gcggccgggg cgccgacatc       600
     ctcgggtcgc cgatcgccgc cgtggcgtgg ctcgccggct acctcgccga gcgtgatctg       660
     tgcctcaatg ccggcgacct cgtcgccacc gggagctgca ccggcctcat ccaggtcctg       720
     cccggccaga ccgtgctggc cgagttcggg ccattgggcc gcgtcacgct ccggatcgcg       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page