(data stored in ACNUC7421 zone)

EMBL: CP001349.PE194

CP001349.PE194       Location/Qualifiers
FT   CDS_pept        complement(222484..224025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0201"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: alpha amylase 3 (IC)"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55246"
FT                   /db_xref="GOA:B8I9J3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012850"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J3"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACL55246.1"
FT                   /translation="MRCRSILIAFIAMLPVALALPRAAHGQAGFDDDRVLLQSFYWESY
FT                   RHGHPVKFPAYGNKRWYRIVAELAPAIRAGRFDLIWLPSPSFSGAHAACMPRECLHSAG
FT                   YNPKEYFDLDNSYGDAAEHASMLTNLLGNGVEPVADLVLNHRDGSQSWGDFRNPDWGPW
FT                   AITRDDEAFTNPASPLFNLPVPQRGAPEEKPVEYARHGGTTYAYGSFRDLDHTNEQVRR
FT                   DIIRYLLQLKSLGYRGWRYDMVHGYHARWIAVYNRASAPTFSVGEYDWDKPDEQRGWVW
FT                   FTAAVPGRLETSSSVFDFMTQFYLKDHKGDSVAQYGTGRGLVGDTTDGQPWKNKAVTFL
FT                   ENHDTGYRTNEDGTPENSHTADSFANGWEVEQGYARILTHPGVPAVYWKHYFDWGPDLS
FT                   AKIRALINARKVAGVHAGSAVHPQDNARSANVYAARVEGRNGDLYVRIGGSDTDWQPSR
FT                   SGYRDYREYARGAGWTVWVGLSGNPAFQEAPLRAPLPIPIYRDPQTIDVPDRLLN"
     atgcgttgcc gatcgatcct gatcgcgttc atcgccatgc tgccggttgc gctcgctctg        60
     ccgcgtgcag cgcacgggca agctggattc gacgatgacc gtgttctgtt gcagagcttc       120
     tactgggaat cctatcggca cggccacccc gtcaagttcc cggcctacgg caacaagcgt       180
     tggtatcgta tcgttgcgga actcgctcca gccatccgcg cgggccgctt tgatctcatc       240
     tggctgcctt cgccctcctt ttctggcgct cacgcggcat gcatgccgcg cgaatgcctc       300
     cacagcgcag gctacaaccc caaagagtat ttcgacctcg acaacagcta cggtgatgct       360
     gccgagcacg cgtccatgct gacgaacctg ctcggcaacg gggtcgagcc ggttgccgat       420
     ctcgtcctca accaccgcga tggatctcag agctggggcg acttcaggaa tccggattgg       480
     ggtccgtggg cgataacgcg cgacgatgag gcgttcacca accccgcctc acccctgttc       540
     aacctgcccg tgcctcaaag aggcgctccg gaagagaagc cggtcgagta tgcccgacac       600
     ggcgggacca cctatgccta tggctcgttc cgggacctcg accacaccaa tgagcaagtc       660
     cgccgggaca tcatccgtta cctgcttcag ctgaagagtc tcggctaccg cgggtggcgc       720
     tacgacatgg tccacggcta ccacgccagg tggatcgccg tgtacaaccg cgcctccgcc       780
     ccaaccttct cggtgggcga atacgattgg gacaagccgg acgaacaacg agggtgggtg       840
     tggtttacgg ctgccgttcc gggtcgcctg gagacgtcca gcagcgtgtt cgacttcatg       900
     acccagttct acctgaagga ccacaagggc gactccgtcg cgcaatacgg caccgggcgc       960
     ggcctcgtcg gcgacaccac cgatggacag ccctggaaga acaaggcagt cacctttctg      1020
     gagaaccatg acacgggcta ccggaccaac gaggacggca cgcctgagaa cagccacacg      1080
     gccgacagct ttgcgaacgg ctgggaggtg gagcagggat atgcccgtat tctcacccac      1140
     cctggcgtgc cggcggttta ctggaagcac tactttgatt ggggccctga cctgagcgcc      1200
     aagatccgtg cgctgatcaa tgcccggaag gtggcaggcg tgcacgccgg cagtgccgtc      1260
     cacccgcagg acaacgcgcg ttcagccaac gtctatgccg cccgcgtaga ggggcggaac      1320
     ggggatctct acgtcaggat cggaggaagc gacacggact ggcagccgtc ccggtcgggc      1380
     tatcgcgact accgcgaata tgcccggggg gccgggtgga cggtgtgggt ggggctctcc      1440
     ggcaatcctg ctttccagga ggctccgctc agggcgccct tgccgatccc gatctaccgg      1500
     gacccgcaga cgatcgacgt gcccgatcgc ctgctcaatt ag                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page