(data stored in ACNUC7421 zone)

EMBL: CP001349.PE195

CP001349.PE195       Location/Qualifiers
FT   CDS_pept        complement(224145..224357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0202"
FT                   /product="protein of unknown function DUF1458"
FT                   /note="PFAM: protein of unknown function DUF1458; KEGG:
FT                   met:M446_1265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55247"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J4"
FT                   /inference="protein motif:PFAM:PF07311"
FT                   /protein_id="ACL55247.1"
FT                   /translation="MSEHVYKLTEIVGSSTVSIEDAIQTAIARAGSTLRNLRWFEVQET
FT                   RGQIANGKIQHFQVTLKVGFTMEDS"
     atgtctgaac atgtatacaa actgaccgag attgtcggtt cgtcgaccgt gtcgatcgaa        60
     gatgcgattc agacggccat cgctcgcgcc ggaagtacct tgcgcaatct ccggtggttc       120
     gaggtgcagg aaacgcgcgg ccaaatcgcc aacggcaaaa ttcagcactt ccaggttaca       180
     ttgaaggtcg gcttcacgat ggaagacagc tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page