(data stored in ACNUC7421 zone)

EMBL: CP001349.PE196

CP001349.PE196       Location/Qualifiers
FT   CDS_pept        224742..226736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0203"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51;
FT                   penicillin-binding protein transpeptidase; KEGG:
FT                   met:M446_3785 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55248"
FT                   /db_xref="GOA:B8I9J5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J5"
FT                   /inference="protein motif:PFAM:PF00912"
FT                   /protein_id="ACL55248.1"
FT                   /translation="MRRRVGLALLCSAAIAGPAHAGPAESLSFWDLKPGQLRILVASPQ
FT                   VMVTRTASGWEAYCRCPVVLKPNEIPEAMKKAIIAVEDRRFMEHGGVDLVALAAVLRGG
FT                   LSRGGSTIPMQLLKNLVFHDLQGRDLFSKLERKGSEVWHAGTFDGAVGKQELLAAYLNQ
FT                   IEFGGREIVGLYRASRYYFHKEPRDLNLFECALLAGMVQAPARFNPVKETTKERAYERA
FT                   RLVLGLMVQQGKISQAERLRAERVGVRPGLLPEFRIQAQPFTEWIVQTLAPRFVQEGET
FT                   IRFFVTLEPRFQRLAEKQLSDMVGEGTIPAEYEAGAVMMSGDGRVRAMIGSVDWSRRQF
FT                   NAAVKTSVQPGSTAKLPLIVAACEAGLSPQSRVVDRPITATWPANGHLGYKGETTLLEA
FT                   MASSRNAAAVRLTQDLGVRRVAAVSRRLGIEPGPDPDAGFVLGSFSTNVLSMTAAYATV
FT                   ANGGYRVAPTGVLAVVDGRGQVRASFLDPIRTRVIPQNCVAPTRSILREVVRSGTGRSA
FT                   GLGRWAAYGKTGTSTGNADAWFVGWSEGRVLGVWMGRRRDAVGEGLAGKGAPAEYFRRV
FT                   SSSANEMVEYRIAQQRGKAGSRTAGGPDRQKAANPQKAPEHRPVHASLAPRLDGPEAIR
FT                   LNAAPRPPLRPFREAVPWLRDEDEDLSPW"
     atgcgccgcc gtgtcggcct cgccctgctc tgctcggccg cgatcgccgg cccggctcat        60
     gccggccccg ccgagagcct gtccttctgg gatctcaagc ccgggcagct gcgcattctg       120
     gtcgcctcgc cgcaggtcat ggtcacccgc accgcatccg gctgggaggc ctattgccgc       180
     tgtcccgtag tgctcaagcc gaatgaaatc ccggaggcga tgaagaaggc catcatcgcc       240
     gtcgaggatc ggcgcttcat ggagcacggc ggcgtcgacc tcgtcgctct ggcggcggtg       300
     ctccgcggcg gactgagtcg aggcggcagc accataccca tgcagctcct caagaacctc       360
     gtgttccacg atctgcaggg ccgcgacctc ttcagcaagc tcgaacgcaa gggctccgag       420
     gtctggcatg ccggaacctt cgacggggcc gtcggcaaac aggagctgct tgcggcctat       480
     ctcaaccaga tcgagttcgg cggacgcgag atcgtcggcc tctatcgcgc gagccggtac       540
     tacttccaca aggagccccg ggacctgaac ctgttcgagt gcgcgctgct agccggcatg       600
     gtgcaggcgc ctgcccggtt caatccggtc aaggagacca caaaggagcg cgcctatgag       660
     cgcgcgaggc tcgtgctcgg cctcatggtc cagcagggca agatcagcca ggccgagcgg       720
     ctgcgggccg agcgggtcgg cgtgcgcccg gggctgctgc cggagttcag gatccaggcg       780
     cagcccttca cggagtggat cgtccagacc ttggccccac gcttcgtgca ggagggtgag       840
     acgatcaggt tcttcgtcac cctggagcct cggtttcagc gcctggccga gaagcagctg       900
     agcgacatgg tcggcgaggg gaccatcccg gccgaatacg aggcgggggc cgtgatgatg       960
     tccggcgacg ggcgggttcg cgcgatgatc ggcagcgtgg attggtcgcg tcggcagttc      1020
     aacgcggccg tgaagacgag cgtgcagccc ggctcgacgg cgaagctgcc gctgatcgtg      1080
     gcggcctgcg aggccggcct ctcgccgcag agccgggtgg tcgatcgtcc gatcaccgcg      1140
     acgtggcccg ccaacggaca tctcggctac aaaggtgaga cgacgctcct ggaggcgatg      1200
     gcgtcctctc gaaatgccgc ggccgtccgg ctcacccagg atctcggggt tcggcgcgtg      1260
     gcggcggtga gccgccggct cggcatcgag ccggggcccg atccggatgc gggcttcgtc      1320
     ctcggctcct tctcgaccaa cgtgctgagc atgacggcgg cttacgccac ggttgcgaac      1380
     ggtggctatc gcgtcgcgcc gaccggcgtg ctcgccgtcg tggacggccg cgggcaggtg      1440
     cgcgcgagct tcctggaccc gatccggacg cgggtcatcc cgcaaaactg cgtcgcaccg      1500
     acacgcagca tcctgcggga ggtcgtccgc tccgggacag gacggagcgc cggcctgggc      1560
     cgatgggcgg cgtatggaaa gacggggacc tccacgggca acgccgatgc gtggttcgtg      1620
     ggctggagcg aggggcgtgt cctgggcgtc tggatggggc ggcggcgtga tgccgtcgga      1680
     gagggcctgg ccggcaaagg ggcgcccgcc gagtacttcc ggcgcgtgtc gtccagcgcg      1740
     aacgagatgg tggaataccg catcgctcag cagcgcggca aagccggcag ccgaaccgca      1800
     ggcgggcccg atcgccagaa agccgccaat ccgcagaagg cgcccgagca caggccggtt      1860
     cacgcgagcc tggcgccacg cctcgacgga cctgaagcga tccgactgaa tgccgccccg      1920
     cgcccgcctt tgcggccgtt cagagaggcc gtgccctggt tgcgcgacga ggacgaggac      1980
     ttgagcccct ggtga                                                       1995
//

If you have problems or comments...

PBIL Back to PBIL home page