(data stored in ACNUC7421 zone)

EMBL: CP001349.PE198

CP001349.PE198       Location/Qualifiers
FT   CDS_pept        227335..228603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3789 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55250"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J7"
FT                   /inference="similar to AA sequence:KEGG:M446_3789"
FT                   /protein_id="ACL55250.1"
FT                   /translation="MAIARARRLRRSAAWILSLLARPARRAQVTQGVAVEAYRGYGSAE
FT                   EIFLIGRVFRQSGTERDADPDDLRAQLRDIGRRIRRRRLADVGVTACFGGSAVRVATDG
FT                   DGYFRIHLRPREPPRSEGAWHPVEITLDADPPVHAQGEVFIPPERCRFVVISDIDDTVM
FT                   HTGVANKLKMLWRLFVADAASRVAFPGVAALYRALHAGPAGAERNPMLYVSRAPWGIYD
FT                   MLSEFFRLHAIPVGPVLFLREWGLSWRHPLPRRAEEHKRDLIGHMLTLYHDLPFVLIGD
FT                   SGQHDPEVYARIVSENPGRVLAVYIRNVSREASRAAEIEQLAKTVAAAGSSLVLAADSR
FT                   AIAEHAARLGLIAAQAVEDVASEKVAAEGAGRRSPLRRISRSTPDATAAAVTGGELDAA
FT                   LDDSSPDPPNVIVEPAHRGHTGS"
     atggccatcg ctcgggctcg ccggctgagg cgttccgccg cctggattct gagcctgctc        60
     gcgcggccgg cgcgcagggc gcaagtgacg caaggcgtgg cggtcgaagc ctatcgcggc       120
     tacggctccg ccgaggagat cttcctcatc ggccgcgtgt tccggcaatc cggcacggag       180
     cgcgacgcgg acccggacga cctgcgcgcg cagttgcgcg acatcggccg gcggatccgg       240
     cgccggcgcc tcgccgatgt cggcgtgacg gcgtgcttcg gcggcagcgc ggtgcgcgtc       300
     gcgaccgacg gagacggtta cttccgcatc cacctgcgcc cccgcgagcc gcctcggagc       360
     gagggggcgt ggcacccggt cgagatcacc ctcgacgcgg atcctccggt tcacgcgcag       420
     ggcgaggtgt tcatcccgcc cgagcgctgc cgcttcgtgg tgatcagcga catcgacgac       480
     accgtcatgc acaccggtgt cgccaacaag ctcaagatgc tctggcgcct gttcgtcgcc       540
     gacgcggcga gccgggtcgc ctttccgggc gtcgcggcgc tctaccgcgc gctccatgcc       600
     ggccccgccg gcgcggagcg gaacccgatg ctctacgtgt cgcgcgcgcc ttggggcatc       660
     tacgacatgc tctcggagtt cttccggctg catgccattc cggtcgggcc ggtgctgttc       720
     ctgcgcgagt gggggctgtc gtggcgccat cccctgccgc gtcgggccga ggagcacaag       780
     cgcgatctga tcggccacat gctcacgctc taccacgacc tgccgttcgt gctgatcggc       840
     gacagtggtc agcatgatcc cgaggtctac gcgcggatcg tgagcgagaa ccccggccgg       900
     gtgctggcgg tctacatccg caacgtgtcg cgcgaggcga gccgcgcagc ggagatcgag       960
     cagcttgcga agacggtcgc ggcggcagga agcagcctcg tgctggctgc cgacagccgc      1020
     gcgatcgccg agcacgcggc acgcctcggc ctgattgctg cgcaagcggt ggaggatgtc      1080
     gcctcggaga aggtggcggc cgaaggcgca ggccgacggt ctccgctacg ccggatcagc      1140
     aggtccacgc ccgatgccac cgccgcggcc gtgaccggag gagaactgga cgctgcgctc      1200
     gatgactcgt cgcccgatcc cccgaacgtc atcgtcgagc ccgcgcaccg gggtcacacc      1260
     ggctcatag                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page