(data stored in ACNUC7421 zone)

EMBL: CP001349.PE199

CP001349.PE199       Location/Qualifiers
FT   CDS_pept        complement(229118..230911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0206"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /note="TIGRFAM: single-stranded-DNA-specific exonuclease
FT                   RecJ; PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: met:M446_3141
FT                   single-stranded-DNA-specific exonuclease RecJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55251"
FT                   /db_xref="GOA:B8I9J8"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J8"
FT                   /inference="protein motif:TFAM:TIGR00644"
FT                   /protein_id="ACL55251.1"
FT                   /translation="MTALIDHPRPLLDVHRSVLGRPWRDRCAEAGPQAAAVTIAQSHGL
FT                   PEVLARVLAGRGVAPGEVPGFLEPRLRDLMPDPSILVDMEAAADRLAHAVLRREKVAIF
FT                   GDYDVDGAASAALLAGTLRDLGVPFRLHIPDRITEGYGPNGEAIRMLAGEGASLLVTVD
FT                   CGTAGHGPLAEAARLGLDVLVLDHHGAPETLPPARAVVNPNRLDDLSGLGHLCAAGVVF
FT                   LTLVALKRRLRRDGVEVPDLMAGLDLVALATVADVVPLLGLNRAFVRQGLAVMRGRGRR
FT                   GLAALLDAAGLAEPPQAWHLGFLVGPRINAGGRIGDATLGARLLLCEDPIEAAGIAAQL
FT                   DQLNRERQAIEAAAVAEAEALAALRLERDPDQPVIVAGSPDWHPGVVGLIAARLKERFG
FT                   RPAFAFALREDGTATGSGRSIIGADLGRAVRRAVEAGLAAKGGGHAMAAGVTLAAVDLD
FT                   RFRDGLSQELAAAVGDARAAQALLVDGVLSAGGVQPDLVAAVERAGPFGQGAPEPVFAL
FT                   ARHRIADARIVGTGHVKAQLRGRDGVTVGAIAFRAAEGPLGQLLLRSIGRDIHAAGTLS
FT                   RDRWRGGERVQLRLCDAAETV"
     gtgaccgccc tcatcgacca cccgcgcccg ctcctcgacg ttcaccgctc cgtgctcggc        60
     cgcccctggc gcgaccgctg cgccgaggcc ggcccccagg cggcggccgt caccatcgcg       120
     cagagccacg gccttcccga ggtgctggcc cgggtgctcg cgggccgcgg cgtcgccccg       180
     ggcgaggtgc cgggcttcct cgagccgcgc ctgcgcgatc tgatgccgga cccgagcatc       240
     ctcgtcgaca tggaggcggc ggccgatcgg ctcgcgcatg cggtgctccg gcgcgagaag       300
     gtcgcgatct tcggcgatta cgatgtcgac ggcgcggcga gcgccgcgct cctcgccggc       360
     acgctgcgcg atctcggcgt gccgttccgc cttcacatcc cggaccggat caccgagggc       420
     tatggcccga atggcgaggc catccgcatg ctggcagggg agggggcgag cctcctcgtc       480
     acggtggatt gcggcaccgc ggggcacgga cccctggccg aggccgcgcg gctcggcctc       540
     gacgtgctgg tcctcgatca tcacggcgct cccgagacgc ttcccccggc ccgggccgtc       600
     gtgaacccga atcgcctcga cgacctctcg gggctcggtc atctctgcgc ggcgggcgtg       660
     gtcttcctca ccctggttgc gctcaagcgg cggctgcgcc gcgacggcgt ggaggttccc       720
     gacctgatgg ccggcctcga cctcgtggcg ctcgctaccg tcgccgatgt ggtgcccttg       780
     ctcggcctca accgcgcctt cgtgcgccag gggcttgcgg tgatgcgcgg gcgcgggcgg       840
     cgcggcctcg cggcgctcct cgacgctgcg ggcctcgcgg aaccgccgca ggcttggcat       900
     ctcggcttcc tggtcggccc ccgcatcaat gccggagggc ggatcggcga cgccactctc       960
     ggcgcgcgcc tcctcctctg cgaggatccg atcgaggcgg ccggcatcgc cgcgcagctc      1020
     gatcagctca accgggagcg acaggccatc gaggccgccg ccgtggccga ggccgaggct      1080
     ctggccgccc tgcgcctgga gcgcgatccg gaccagccgg tgatcgtggc cgggagcccc      1140
     gattggcatc cgggcgtcgt gggcctgatc gcggcgcggc tcaaggagcg gttcgggcgc      1200
     ccggccttcg ccttcgccct gcgcgaggac ggcactgcca ccgggtccgg gcgctccatc      1260
     atcggggctg atctcggccg ggcagtgcgc cgggccgtgg aggcggggct cgcagctaag      1320
     ggcggcggcc acgccatggc ggcgggcgtg acgctcgccg ccgtcgatct cgaccggttc      1380
     cgcgacgggc tctcccagga acttgccgcg gcggtggggg atgcccgcgc cgctcaggcc      1440
     ctcctcgtcg acggagtgct ctcggccgga ggcgtgcagc ccgatctcgt cgcggcggtg      1500
     gagcgggccg gtcccttcgg ccagggggcg cccgagcccg tcttcgcgct cgcccgccac      1560
     cggatcgcag atgcccgcat cgtcggcacc ggccacgtca aggcacagtt gcgcggacgc      1620
     gacggcgtca ccgtgggggc gatcgccttc cgggccgccg aggggccgct cggtcaactg      1680
     ctcctgcgca gcatcggccg ggacatccat gccgccggca cgctgtcgcg cgaccgttgg      1740
     cgcggcgggg agcgggttca gctgcggctg tgcgatgcgg ccgagaccgt ctga            1794
//

If you have problems or comments...

PBIL Back to PBIL home page