(data stored in ACNUC7421 zone)

EMBL: CP001349.PE2

CP001349.PE2         Location/Qualifiers
FT   CDS_pept        1663..2784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; KEGG: met:M446_0002 DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55054"
FT                   /db_xref="GOA:B8ISZ2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ2"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACL55054.1"
FT                   /translation="MRVTVERAALLRSLGHVHRVVERRNTIPILSNVLLRSSADGLQLK
FT                   ATDLDIEVTETIPADVADGGATTVPAHVIYDIVRKLPEGAQVSLETTGDTGQMLIRSGR
FT                   SRFTLGALPETDFPDLAAGELPHRFQLQAAELKKLIDKTQFAISTEETRYYLNGIFFHT
FT                   IEAEGGVKLRAVATDGHRLARVEMPAPEGSHGMPGIIVPRKAVAEIQKLVEDGGDSVGV
FT                   EISSAKVRFTFSTGVMLISKLIDGTFPDYQRVIPTGNDKLLTVERDQFAKAVDRVSTIS
FT                   SERGRAVKLAVAGGRLSLSVNNPDSGSATEELDADYEAAPLDIGFNARYLLDITAQLDG
FT                   DTALFKLADPGSPTLIQDKDGAPALYVLMPMRV"
     atgagagtca cagtcgagcg cgcggccctc cttcggtcgc tcggccacgt gcaccgcgtc        60
     gtggagcggc gcaacacgat cccgatcctg tcgaacgtgc tgctgcgctc gagcgccgac       120
     ggcctgcagc tcaaggcgac cgacctcgac atcgaggtga ccgagaccat cccggccgac       180
     gtggccgacg ggggcgccac cacggtcccg gcccatgtca tctacgacat cgtccgcaag       240
     ctgccggagg gcgcgcaggt ctccctggag acgaccggtg ataccggcca gatgctgatc       300
     cgctccggcc gctcgcgctt cacgctcggc gccctgccgg agaccgattt cccggacctc       360
     gccgcgggcg agctgcccca tcgcttccag ctccaggccg cggagctgaa aaagctcatc       420
     gacaagaccc agttcgcgat ctccacggag gagacgcgct actacctcaa cggcatcttc       480
     tttcacacga tcgaggcgga gggcggcgtg aagctgcgcg cggtcgccac cgacgggcac       540
     cgcctcgccc gcgtcgagat gccggcgccc gagggcagcc acggcatgcc gggcatcatc       600
     gtgccgcgca aggccgtggc cgagatccag aagctcgtgg aggatggcgg cgacagcgtc       660
     ggcgtcgaga tctcctccgc caaggtgcgc ttcacgttct cgaccggcgt catgctgatc       720
     tcgaagctca tcgacggcac cttcccggac taccagcgcg tcatcccgac cgggaacgac       780
     aagctcctga ccgtggagcg cgaccagttc gccaaggcgg tcgaccgcgt ctcgaccatc       840
     tcctccgagc ggggccgggc cgtgaagctt gcggtggccg gcggacgcct ctcgctctcg       900
     gtgaacaacc cggattccgg cagcgccacc gaggagctcg atgccgatta cgaggcggcg       960
     cccctcgata tcggtttcaa cgcccgctat ctcctcgaca tcaccgcgca gctcgacggg      1020
     gacaccgccc tgttcaagct cgccgatccg ggctcgccga ccctgatcca ggacaaggac      1080
     ggagcccccg cgctctacgt cctgatgccg atgcgggtgt ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page