(data stored in ACNUC7421 zone)

EMBL: CP001349.PE20

CP001349.PE20        Location/Qualifiers
FT   CDS_pept        complement(22760..23692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0021"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: met:M446_0018
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55072"
FT                   /db_xref="GOA:B8IT10"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT10"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ACL55072.1"
FT                   /translation="MNPPSPTSRALCTLSRRKLILGASAAALTGSAARAAETPVTVASK
FT                   GDAEGTLLGQMILQTLRRIDIPVVDRLQLGPTRIVRTALVAGEIDAYPEYTGNVAFFSG
FT                   TETDPAWKRAETAYAAARRFDASRGLVWLTPARANNSWQIAVRGGLARAEGLSSMEDFA
FT                   RAVRRGLIEFAASAEFVESPAALAAYEQAYGFVLPRERIVTLPGGDTSVTLRAAAQGIS
FT                   GVNAGMVYGTDGAITALDVVVMADPKGAQIVYEPAPVFREPVLARHPAIAPALDRVFAG
FT                   LDLPTLRRLNAAITVEGETPEAVARRHLG"
     atgaaccctc cctctccaac gtcgcgggcc ttgtgcacac tcagccgccg caagctgatt        60
     ctcggggcga gtgccgccgc gctcaccggg agcgccgccc gcgcggcgga gacgcccgtg       120
     accgtggcct cgaagggcga tgcggagggc acgctgctcg gccagatgat cctccagacc       180
     ctgcgccgca tcgacatccc ggtcgtcgac cggctgcagc tcgggccgac gcggatcgtc       240
     cgcacggccc tcgtcgcggg cgagatcgac gcctatccgg aatataccgg caacgtggcg       300
     ttcttctcgg ggacggagac cgatccggcc tggaagcgtg ccgaaaccgc ctacgcggcg       360
     gcgcggcgct tcgacgcctc gcgcgggctg gtctggctga cgcccgcgcg ggcgaacaat       420
     tcctggcaga tcgccgtgcg gggcggcctc gcgcgggccg aggggctgtc gagcatggag       480
     gatttcgccc gggcggtccg gcgcggcctg atcgagttcg ccgcctccgc cgagttcgtg       540
     gagagcccgg cggcgctcgc ggcctacgag caggcctacg gcttcgtcct gccccgggag       600
     cgcatcgtca cgctgccggg cggcgacacc tcggtcaccc tgcgggcggc cgcccagggg       660
     atcagcggcg tcaatgccgg gatggtctac ggcaccgacg gggccatcac cgccctcgac       720
     gtagtggtga tggccgatcc caagggcgcg cagatcgtct acgagccggc cccggtcttc       780
     cgcgagcccg tcctcgcccg ccacccggcg atcgcgcccg ccctcgacag ggtcttcgcg       840
     gggctcgacc tgccgaccct gcgccgcctc aacgccgcca tcaccgtcga gggcgagacc       900
     cccgaggcgg tggcccgtcg ccatctcggg tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page