(data stored in ACNUC7421 zone)

EMBL: CP001349.PE200

CP001349.PE200       Location/Qualifiers
FT   CDS_pept        complement(231185..232582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0207"
FT                   /product="NAD(P) transhydrogenase beta subunit"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: NAD(P) transhydrogenase beta subunit; KEGG:
FT                   met:M446_3142 NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55252"
FT                   /db_xref="GOA:B8I9J9"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J9"
FT                   /inference="protein motif:PFAM:PF02233"
FT                   /protein_id="ACL55252.1"
FT                   /translation="MSENISSLLYIVAGVLFIMALRGLSHPTTSRQGNLYGMVGMGIAI
FT                   LTTLVGHAPAGAGAWLLVLLGLGIGGGVGAVIARRVPMTAMPQLVAAFHSLVGLAAVAV
FT                   AAGALYAPHAFGILEGGHIHKQSLFEMGLGVAIGAITFTGSVIAFLKLDGRMSGKPIML
FT                   PQRHLINILLGVLLVVLLATFIANESKVLFWLIVLLSFALGGLLIIPIGGADMPVVVSM
FT                   LNSYSGWAAAGIGFTLGNLALIITGSLVGSSGAILSYIMCHAMNRSFISVILGGFGGES
FT                   AVAAGGQVEARPVKQGSADDAAFIMKNAEKVIIVPGYGMAVAQAQHSLREMADQLKKEG
FT                   VEVKYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEDINGEFPQADVAFVIGANDVTNP
FT                   AAKTDPQSPIFGMPILDVEKAKTVLFVKRGMGSGYAGVENEVFFRDNTMMLFGDAKKVV
FT                   DEIVKSF"
     atgtcggaga acatctcttc ccttctctac atcgtcgccg gcgtcctgtt catcatggcg        60
     ctgcggggcc tgtcgcaccc gaccacctcc cggcagggca acctgtacgg catggtcggc       120
     atggggatcg cgatcctgac cacgctcgtc ggccacgcgc ctgccggcgc gggcgcgtgg       180
     ttgctggtgc tgctcggcct cggaatcggc ggcggcgtgg gcgccgtcat cgcccggcgc       240
     gtgccgatga ccgcgatgcc gcagctcgtg gcggccttcc actccctcgt cggtctcgcg       300
     gccgtggcag tggcggcggg cgcgctctac gcgccgcatg ccttcggcat cctggaaggc       360
     ggccacatcc acaagcagtc cttgttcgag atggggctcg gcgtcgccat cggcgccatc       420
     accttcacgg gctcggtgat cgccttcctc aagctcgacg ggcgcatgtc gggcaagccg       480
     atcatgctgc cgcagcggca cctcatcaac atcctgctgg gcgtcctgct cgtcgtcctg       540
     ctcgcgacct tcatcgccaa cgagagcaag gtcctcttct ggctgatcgt gctcctgtcc       600
     ttcgcgctgg gcgggctcct gatcatcccg atcggcggcg ccgacatgcc ggtcgtcgtc       660
     tcgatgctca actcctattc gggctgggcc gcggcgggca tcggcttcac gctcggcaac       720
     ctcgcgctga tcatcaccgg ctccctggtc ggctcctcgg gcgcgatcct gtcctacatc       780
     atgtgccacg cgatgaaccg ctcgttcatc tcggtgatcc tgggcggctt cggcggcgaa       840
     tccgccgtcg cggccggcgg gcaggtcgag gcgcggccgg tgaagcaggg ctcggcggac       900
     gatgcggcct tcatcatgaa gaatgccgag aaggtcatca tcgtgccggg ctacggcatg       960
     gcggtggcgc aggcccagca ctcgctccgc gagatggccg accagctcaa gaaggagggc      1020
     gtcgaggtca agtacgccat ccacccggtg gcgggccgca tgccgggcca catgaacgtg      1080
     ctcctcgccg aggcgaacgt gccctacgac gaggtgttcg agctggagga catcaacggc      1140
     gagttcccgc aggcggatgt cgccttcgtg atcggcgcca acgacgtcac caacccggcc      1200
     gccaagacgg atccgcaatc gccgatcttc ggcatgccga tcctcgacgt ggagaaggcc      1260
     aagaccgtgc tgttcgtcaa gcgcggcatg ggctcgggct atgcaggcgt cgagaacgag      1320
     gtgttcttcc gcgacaacac catgatgctg ttcggcgacg ccaagaaggt ggtcgacgag      1380
     atcgtcaaga gcttctga                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page