(data stored in ACNUC7421 zone)

EMBL: CP001349.PE201

CP001349.PE201       Location/Qualifiers
FT   CDS_pept        complement(232587..233036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0208"
FT                   /product="PntAB, NAD(P) transhydrogenase, alpha2 subunit"
FT                   /note="KEGG: met:M446_3143 PntAB, NAD(P) transhydrogenase,
FT                   alpha2 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55253"
FT                   /db_xref="GOA:B8I9K0"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K0"
FT                   /inference="similar to AA sequence:KEGG:M446_3143"
FT                   /protein_id="ACL55253.1"
FT                   /translation="MATLPPDQAAEQARAAAAAARTAADIAAKAAEQAQAIADAAGHGI
FT                   AAVTHGAVDPTVFRLAIFVLAIFVGYYVVWSVTPALHTPLMSVTNAISSVIVVGALLAV
FT                   GVPLVEKGTGIARFLGFLGLVFASVNIFGGFLVTQRMLGMYKKKA"
     atggcgacgc ttcctccaga ccaggcggcc gagcaggcgc gcgcggcggc tgccgccgcc        60
     cggaccgccg ccgacatcgc ggccaaggcc gccgaacaag cccaggccat cgccgatgcg       120
     gccggccacg gcatcgcggc cgtcacccac ggcgcggtcg atcccaccgt gttccgcctc       180
     gcgatcttcg tgctggcgat cttcgtcggc tattacgtgg tctggtcggt gaccccggcc       240
     ctccacaccc ccctgatgtc ggtcaccaac gcgatctcgt cggtgatcgt ggtcggcgcg       300
     ctcctcgcgg tcggcgttcc gctcgtcgag aagggcaccg gaattgcccg cttcctcggc       360
     ttcctcggcc tcgtcttcgc gagcgtgaac atcttcggcg gcttcctcgt cacccagcgc       420
     atgctcggca tgtacaagaa gaaggcgtga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page