(data stored in ACNUC7421 zone)

EMBL: CP001349.PE202

CP001349.PE202       Location/Qualifiers
FT   CDS_pept        complement(233054..234193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0209"
FT                   /product="alanine dehydrogenase/PNT domain protein"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: alanine dehydrogenase/PNT domain protein;
FT                   KEGG: met:M446_3144 NAD(P)(+) transhydrogenase
FT                   (AB-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55254"
FT                   /db_xref="GOA:B8I9K1"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K1"
FT                   /inference="protein motif:PFAM:PF01262"
FT                   /protein_id="ACL55254.1"
FT                   /translation="MRIAVLSETDPAEPRVAAIPETVKKYKSLGADVTVQSGAGAKAGL
FT                   PDSEFEAVGATIAPDAAAAAKDAEIVLRVRRPAAEELPGLKRGAIVVGIMDPYGHEAEI
FT                   KALADAGVAAIAMELMPRITRAQVMDVLSSQANLAGYRAVVDGAAVYGRALPMMMTAAG
FT                   TVPAARVFVMGAGVAGLQAIATARRLGAVVTATDVRPAAKEQVESLGAKFIAVEDEEFK
FT                   QAETAGGYAKEMSAEYRRKQAELVASHIAKQDIVITTALIPGRPAPRLVTAEMIAAMRP
FT                   GSVLVDLAVERGGNVEGAKADEIVETPNGVKIVAYANVPGRLAATSSSLYARNLYAFVE
FT                   TLIDKASKSLAVKWDDELVKATCLTRDGAVIHPNFQPNA"
     atgcggatcg cggtgctatc cgagaccgac ccggcggagc cgcgcgtcgc ggcgatcccc        60
     gagacggtca agaaatacaa gtcgctcggc gccgacgtga cggtccagtc gggtgccggc       120
     gccaaggccg ggcttcccga cagcgagttc gaggccgtcg gcgcgaccat tgcgccggac       180
     gcagccgcgg ccgcgaagga tgccgaaatc gtgctgcgcg tccgccggcc ggccgccgag       240
     gagctcccgg ggctcaagcg cggagcgatc gtcgtcggga tcatggaccc ctacggccac       300
     gaggccgaga tcaaggccct ggccgatgcg ggggttgccg ccatcgccat ggagctgatg       360
     ccgcgcatca cccgcgcgca ggtgatggac gtgctgtcga gccaggcgaa cctcgccggc       420
     taccgcgccg tggtggacgg ggccgccgtc tacggccggg cgctgcccat gatgatgacc       480
     gcggccggca ccgtgccggc ggcccgcgtc ttcgtgatgg gggccggcgt cgccgggctc       540
     caggccatcg ccaccgcacg ccgcctcggc gccgtggtga cggcgaccga cgtgcgcccg       600
     gccgccaagg agcaggtcga gtcgctcggc gccaagttca tcgccgtcga ggacgaggag       660
     ttcaagcagg ccgagaccgc gggcggctac gccaaggaga tgtcggccga gtaccgccgc       720
     aagcaggcgg agctggtggc gagccacatc gccaagcagg acatcgtcat caccacggcg       780
     ctgatcccgg gccgtcccgc ccccaggctc gtcaccgccg agatgattgc ggcgatgcgg       840
     ccgggctccg tgctggtcga cctcgcggtg gagcgcggcg gcaatgtcga gggcgccaag       900
     gccgacgaga tcgtcgagac gccgaacggc gtgaagatcg tggcctacgc caacgtgccg       960
     ggccgcctcg ccgccacctc gtcgagcctc tacgcgcgca atctctatgc cttcgtcgag      1020
     accctgatcg acaaggcgtc gaagagcctc gccgtgaagt gggatgacga gctcgtcaag      1080
     gcgacctgcc tgacgcgcga cggcgccgtc atccatccga acttccagcc caacgcctga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page