(data stored in ACNUC7421 zone)

EMBL: CP001349.PE203

CP001349.PE203       Location/Qualifiers
FT   CDS_pept        complement(234413..234706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55255"
FT                   /db_xref="GOA:B8I9K2"
FT                   /db_xref="InterPro:IPR012422"
FT                   /db_xref="InterPro:IPR036596"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K2"
FT                   /inference="similar to AA sequence:KEGG:M446_3145"
FT                   /protein_id="ACL55255.1"
FT                   /translation="MASSNHASNDAYGPSMDGDTHEATYRGFVRFVEIATTVVVCWILS
FT                   LGIGGIREAWLTAIFGVVLSGLAGAVGALAPALGWRAPGAVAVLLAVLLALY"
     atggctagca gcaaccacgc ctccaacgac gcttacgggc cctccatgga cggggacacc        60
     cacgaggcga cctatcgcgg cttcgtgcgc ttcgtggaga tcgccaccac ggtcgtggtc       120
     tgctggattc tgtcgctcgg gatcggcggg atccgcgagg cgtggctcac ggcgatcttc       180
     ggcgtcgtgc tgtcgggcct cgccggcgcg gtcggcgccc tggcgccggc gctcggctgg       240
     cgggcgccgg gagcggtggc ggtgctgctc gcggttcttc tcgccctgta ctga             294
//

If you have problems or comments...

PBIL Back to PBIL home page