(data stored in ACNUC7421 zone)

EMBL: CP001349.PE204

CP001349.PE204       Location/Qualifiers
FT   CDS_pept        complement(234853..236214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0211"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: met:M446_3146
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55256"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR034646"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K3"
FT                   /inference="protein motif:PFAM:PF03109"
FT                   /protein_id="ACL55256.1"
FT                   /translation="MSDTEANRFSARAARYARVGANMGGVAARMAGSRLLGRKGEELSN
FT                   AAALAQALGGLKGPIMKVAQLLATVPDLLPPEYAQELQKLQSEAPPMGAAFVKRRMAAE
FT                   LGADWQSRFGSFDLKPSAAASLGQVHRAATRDGAPLACKLQYPDMQSAVEADLKQLEFA
FT                   FALHRRMRIAIDTREIAKEIGDRVREELDYLREAKHAALYSEVLRDIATVRVPGVHPGL
FT                   TTKRLLTLDWLEGEKILTFAQAPLEIRNRLAHAMFKAWWHPFSRAAVIHGDPHLGNYTV
FT                   FSEGGEPQGINLLDYGCIRIFHPRFVGGVVDLYRGLLHDDQERIVHAYESWGFRRLNRE
FT                   LIDILNIWARFIYGPLLEDRVRTVADGVKPGEYGRRQAFEVHRALKERGPVTVPREFVF
FT                   MDRAAVGLGAVFLHLRSELNYHRLFEAEIDRFSLDELAARQKMALEAAKLPLPA"
     atgtccgaca ccgaagccaa ccgcttctcc gcccgcgccg cccgctatgc ccgggtcggc        60
     gccaatatgg gcggcgtcgc ggcccggatg gcggggtccc ggctgctcgg ccggaagggc       120
     gaggagctgt cgaacgccgc cgccctggct caggccctcg ggggcctgaa ggggccgatc       180
     atgaaggtgg cgcagcttct cgccaccgtt cccgatctgc tgccgcccga atacgcccag       240
     gagctgcaga agctgcaatc cgaggcgccg ccgatgggcg ccgccttcgt caagcggcgc       300
     atggcggccg aactcggggc cgattggcag agccgcttcg gcagcttcga cctgaagccc       360
     tccgcggccg cctccctcgg ccaggtgcac cgggccgcga cccgggacgg cgccccgctc       420
     gcctgcaagc tccagtaccc ggacatgcaa tccgccgtcg aggcggatct caagcagctc       480
     gaattcgcct tcgcgctgca ccggcgcatg cgcatcgcca tcgacacccg cgagatcgcc       540
     aaggagatcg gcgaccgggt gcgggaggag ctcgactacc tgcgcgaggc caagcatgcc       600
     gccctctaca gcgaggtgct gcgcgacatc gcgaccgtcc gggtgcccgg cgtgcatccg       660
     ggcctcacga cgaagcgcct gctgaccctc gactggctcg agggcgagaa gatcctgacc       720
     ttcgcgcagg ccccgctgga gatccgcaac cggctcgccc acgcgatgtt caaggcgtgg       780
     tggcacccct tcagccgcgc cgccgtcatc cacggggacc cgcatctcgg caactacacg       840
     gtgttctcgg agggcggcga gccgcagggc atcaacctgc tcgattacgg ctgcatccgc       900
     atcttccacc cgcgcttcgt cggcggcgtg gtcgatctct accggggcct cctgcacgat       960
     gaccaggagc gcatcgtcca tgcctacgag agctggggct tccgccggct caaccgcgag      1020
     ttgatcgaca tcctcaacat ctgggcacgg ttcatctatg ggccgctcct cgaggaccgc      1080
     gtgcgcacgg tggccgatgg ggtgaagccc ggcgaatacg gccggcgcca ggccttcgag      1140
     gtgcaccgcg ccctcaagga gcgcggcccc gtcaccgtgc cgcgggaatt cgtgttcatg      1200
     gaccgggcgg cggtggggct cggggcggtg ttcctgcacc tgcgctcgga gttgaactat      1260
     caccgcctgt tcgaggccga gatcgaccgc ttctcccttg atgagctggc ggcccgccag      1320
     aagatggcgc tcgaagcggc gaagctgccg ctccccgcgt ga                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page