(data stored in ACNUC7421 zone)

EMBL: CP001349.PE205

CP001349.PE205       Location/Qualifiers
FT   CDS_pept        complement(236430..236741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0212"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   met:M446_3147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55257"
FT                   /db_xref="GOA:B8I9K4"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K4"
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /protein_id="ACL55257.1"
FT                   /translation="MDYTYQDGRLQIRRTEEEKRPILQRLKRIEGQVRGLQSMVQEDRY
FT                   CLDEVQQMNAITAAVREAALQLISDHLDASVQYAVSSHDRDGAVEEMIRALRSALRQS"
     atggactaca cctaccagga tggacgcctt cagatccgcc gcaccgagga ggagaagcgg        60
     ccgattctgc agcgcttgaa gcggatcgag gggcaggttc gcggccttca gtccatggtg       120
     caggaggacc gctactgcct ggacgaggtg cagcagatga acgccatcac ggctgcggtg       180
     cgggaggcgg cgctgcagct gatcagcgac catctcgacg cgtccgtgca atatgcggtg       240
     agcagccatg atcgcgacgg ggcggtcgag gagatgatcc gggcgctgcg cagcgccctg       300
     cggcagtcct ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page