(data stored in ACNUC7421 zone)

EMBL: CP001349.PE206

CP001349.PE206       Location/Qualifiers
FT   CDS_pept        complement(237159..239009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0213"
FT                   /product="oligoendopeptidase, pepF/M3 family"
FT                   /note="TIGRFAM: oligoendopeptidase, pepF/M3 family; PFAM:
FT                   peptidase M3A and M3B thimet/oligopeptidase F;
FT                   Oligopeptidase F; KEGG: met:M446_3148 PepF/M3 family
FT                   oligoendopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55258"
FT                   /db_xref="GOA:B8I9K5"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR011977"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K5"
FT                   /inference="protein motif:TFAM:TIGR02290"
FT                   /protein_id="ACL55258.1"
FT                   /translation="MPTRAAAPSEAPQSAAQAMARAVDLGPLPEWDLSDLYAGLDDPAF
FT                   ARDLARAEAECRAFAEAYQGRIAALAAGDGASDRLGTAVAAYEALEDLMGRLLSFAGLV
FT                   YSGDTTDPARAKFYGDTQERLTAASSDLLFFTLELNRVPDEVLDAATALPPLARYRPWI
FT                   EDIRREKPHQLSDELERLLLEKSVTGRAAWNRLFDETVASLRFPVRGELLTLEPTLNKL
FT                   QDADEGLRRDAAEALSGVFRANLRLFTLITNTLAKDKEIADRWRRFGDVADSRHLANRV
FT                   EPEVVAALVEAVTAAYPRLSHRYYRLKARWFGRDSLAYWDRNAPLPKVEQRTIPWAEAR
FT                   ETVLSAYGAFSPRMAEIARTFFDGGWIDAPVRPGKAPGAFAHPTVPSSHPYVLVNYQGK
FT                   PRDVMTLAHELGHGVHQVLAAGNGALMAPTPLTLAETASVFGEMLTFRRVLDATTDRRQ
FT                   RRALLAAKVEDMINTVVRQIAFYVFERELHLARRAGELTADQICALWMSVQAESLGPAI
FT                   RLDAGYEPFWAYIPHFIHSPFYVYAYAFGDCLVNSLYGVYRNAEEGFVDRYFALLSAGG
FT                   SKPYGELLAPFGLDARDPSFWQIGLSMIEGMIAELEEMEA"
     atgccgaccc gagccgccgc gccatcggaa gccccccaga gcgcggccca ggccatggca        60
     cgcgccgtcg atctcggtcc gctgcccgaa tgggacctct cggatctcta tgcgggcctc       120
     gacgaccccg ccttcgcgcg cgatctcgcc cgggccgagg ccgaatgccg ggccttcgcg       180
     gaggcctatc agggcaggat cgccgcgctc gcagccgggg acggcgcctc cgaccgcctc       240
     gggacggcgg tcgccgccta cgaggcgctg gaggacctga tgggccggct cctgtccttc       300
     gcgggtctgg tctattcggg cgacaccacc gatccggccc gcgccaagtt ctacggcgac       360
     acgcaggagc ggctcaccgc ggcgtcgagc gacctcctgt tcttcaccct cgaactcaac       420
     cgcgtgcccg acgaggtgct cgacgccgca accgcgctgc cgccgctcgc gcgctaccga       480
     ccctggatcg aggacatccg ccgcgagaag ccccaccagc tcagcgacga gctggagcgg       540
     ctgctcctgg agaagtcggt caccgggcgg gccgcctgga accgcctctt cgacgagacg       600
     gtcgcttcct tacgctttcc ggtgcgcggc gagttgctca ccctggagcc gacgctcaac       660
     aagctccagg atgcggacga gggcctgcgc cgcgacgccg ccgaggcgct gagcggcgtc       720
     ttccgggcga atctgcggct cttcacgctc atcaccaaca cgctcgccaa ggacaaggag       780
     atcgcggacc gctggcgccg cttcggggac gtggcggatt cccgccactt ggccaaccgg       840
     gtcgagccgg aggtggtggc ggcgctcgtg gaggcagtga ctgccgccta tccgcgcctc       900
     tcccaccgct actaccggct gaaggcgcgg tggttcggcc gcgacagcct cgcctattgg       960
     gaccgcaacg cgccgctgcc gaaggtggag cagcgcacca tcccctgggc cgaggcgcgc      1020
     gagaccgtgc tgtcggccta cggcgccttc tcgccgcgca tggcggagat cgcccgcacc      1080
     ttcttcgacg gcggctggat cgacgcgccg gtgcggcccg gcaaggcgcc cggcgccttc      1140
     gcgcatccga ccgtgccctc ttcccacccc tacgtgctgg tgaactacca gggcaagccg      1200
     cgggacgtga tgacgctcgc ccatgagctc ggccatggcg tccatcaggt gctcgccgcc      1260
     ggcaacgggg cgctgatggc accgacgccg ctgacgctcg ccgagaccgc gagcgtcttc      1320
     ggcgagatgc tgaccttccg ccgcgtgctc gacgccacga ccgatcgccg ccagcgccgg      1380
     gcgctcctcg ccgccaaggt cgaggacatg atcaacacgg tggtgcggca gatcgccttc      1440
     tacgtcttcg agcgcgagct ccacctcgcg cgccgcgcgg gcgagctcac cgccgaccag      1500
     atctgcgccc tctggatgtc cgtccaggcc gagagcctcg ggccggcgat ccggctggat      1560
     gcgggctacg agcccttctg ggcctatatc ccgcacttca tccactcgcc cttctacgtc      1620
     tatgcctacg ccttcggcga ctgcctcgtg aactcgctct acggcgtgta ccggaacgcc      1680
     gaggaggggt tcgtcgaccg ctacttcgcg ctcctgtcgg cgggcgggag caagccctac      1740
     ggcgagctcc tggccccgtt cgggctcgac gcccgcgacc cgtccttctg gcagatcggc      1800
     ctgtcgatga tcgagggcat gatcgcggaa ctcgaagaga tggaggccta a               1851
//

If you have problems or comments...

PBIL Back to PBIL home page