(data stored in ACNUC7421 zone)

EMBL: CP001349.PE207

CP001349.PE207       Location/Qualifiers
FT   CDS_pept        239290..240777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0214"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: met:M446_3149
FT                   two component, sigma54 specific, fis family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55259"
FT                   /db_xref="GOA:B8I9K6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K6"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACL55259.1"
FT                   /translation="MSTTVLIVDDDPVQRRLAEAMVRRLGFEAIVAEGGEAALACLRAP
FT                   DAGIDVVLLDLVMPGGLDGLGVLAEMRRSAIDTPVIVQTANGSIDAVVTAMRAGAIDFV
FT                   VKPAGAERLQVSIKNALQVDQLQDEIRRMRRRASGALTFKDLTSKSPDMGRIIRLAERA
FT                   AKSNIPVLIEGESGVGKEVLARAIQGSGERRGKPFVTVNCGAIPDNLVESTLFGHEKGA
FT                   FTGATERHVGKFVEASGGTLFLDEIGELPLDAQVKLLRALQEGEVDPVGGRKSVRVDIR
FT                   LISATNRSLLDLVKQGRFREDLYYRLNVFPMTLPPLRARREDIPDLARSFCARFAAEEG
FT                   KRVRAITPEAMALITRYDWPGNVRQLENALFRAVVLADGDELTVAEFPQIAAQVEGFDV
FT                   RIPAAPSLPEAVAASAPLREIVRVEVRDPHAISLVSEESGEMKTMEGLEGEIIRYALQF
FT                   YRGRMSEVSRRLGIGRSTLYRKLKDLGIDEDKADDAA"
     atgtcgacca cggtgctcat cgtcgatgac gatcccgtgc aacggcgcct cgcggaggcg        60
     atggtccggc gcctcggctt cgaggcgatc gtggcggagg gcggcgaggc ggcgctcgct       120
     tgcctacgcg ccccggatgc gggcatcgac gtggtgctcc tcgacctcgt gatgcccggc       180
     ggcctcgacg gcctcggcgt gctcgccgag atgcgcagga gcgccatcga cacgccggtg       240
     atcgtccaga ccgcgaacgg ctcgatcgac gccgtggtca cggcgatgcg ggccggcgcc       300
     atcgatttcg tggtcaagcc cgcgggggcc gagcgcctcc aggtctcgat caagaacgcc       360
     ctgcaggtcg accagctgca ggacgagatc cggcgcatgc gccgccgtgc ctcgggggcg       420
     ctgaccttca aggacctgac ctcgaagagc cccgacatgg gccggatcat ccggctcgcc       480
     gagcgggcgg cgaagtcgaa catcccggtg ctgatcgagg gcgagtccgg cgtcggcaag       540
     gaagtgctgg cccgcgccat ccagggctcg ggcgagcggc gcggcaagcc cttcgtcacc       600
     gtcaattgcg gcgcgatccc cgacaacctc gtcgagtcga ccctgttcgg gcacgagaag       660
     ggcgccttca cgggcgccac ggagcgccat gtcggcaagt tcgtggaggc gtcgggcggg       720
     acgctgttcc tcgacgagat cggcgaattg ccgctcgatg cccaggtcaa gctgctccgc       780
     gccctccagg agggggaggt cgatccggtc ggcgggcgca agagcgtgcg ggtcgacatc       840
     cgcctgatct cggccaccaa ccgctcgctc ctcgacctcg tcaagcaggg ccggttccgc       900
     gaggatctct attaccggct caacgtcttc ccgatgaccc tgcccccgct gcgggcgcgc       960
     cgcgaggaca ttcccgacct cgcccgctcc ttctgcgccc gcttcgcggc cgaggagggc      1020
     aagcgcgtgc gggccatcac gccggaggcg atggcgctca tcacccgcta cgactggccc      1080
     ggcaacgtgc gccagctcga gaatgcgctc ttccgcgccg tggtgctggc ggatggcgac      1140
     gagctcacgg tggcggagtt cccgcagatc gccgcgcagg tcgagggctt cgacgtgcgc      1200
     attcccgcag cccccagcct gccggaggcg gtcgctgcct ccgccccctt acgcgagatc      1260
     gtccgcgtcg aggtgcgcga tccgcacgcc atctcgctcg tgtccgagga gagcggcgag      1320
     atgaagacca tggagggact ggagggcgag atcatccgct acgccctgca attctaccgc      1380
     gggaggatgt cggaagtgtc ccgccgcctc ggcatcgggc gctcgacgct ctaccgcaag      1440
     ctcaaggatc tcgggatcga cgaggacaag gcggacgacg ccgcctga                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page