(data stored in ACNUC7421 zone)

EMBL: CP001349.PE208

CP001349.PE208       Location/Qualifiers
FT   CDS_pept        240971..242983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0215"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   ErfK/YbiS/YcfS/YnhG family protein; KEGG: met:M446_3150
FT                   peptidoglycan binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55260"
FT                   /db_xref="GOA:B8I9K7"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K7"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACL55260.1"
FT                   /translation="MLPRRRAAALVAVLMAGAASLAGARAQEAAPPASPPEAAAPTPPA
FT                   AAEAPVQATEPPAETAAPQAQPAEAPAQAAEASKPPLPDDPVAAAIATKLADSTVPLLR
FT                   RFGRREREALQAFYALGAFKPVWITDGAWTDAAKAVIARLGAAGEDGLDPLDYPIPTLG
FT                   IPTGSPADLAEADLKLSAAAALYARDARGGRIEPSRLSRLITPKLDLPSADAVLPRLAA
FT                   AGPGANAVLQSYNPSQTGYLALKAKLAALRSQRPGGVPMVRLPKGPTLKPGMRDARVPL
FT                   IRARFGLGPADDATAYDAAVAGAVERFQRERGLAATGILNPETVAALAGPSPGRQEADL
FT                   LANMERWRWLPADLGKTHVWVNIPEYKVRVVSGTRVVDEARVIVGKPDSPTPVFSGEMT
FT                   YAVVNPSWNVPPSILKNEFLPRLARDPTYAARLGYEVVRRGNGIAIRQPPGERNALGFI
FT                   KFMFPNDHAVYLHDTPNRALFARSARALSHGCVRVDDPFRFAEVVLGPTWPTERLKRLI
FT                   GKGERTVMLPEKLPVHLAYFTLVADEAGTLRQFDDLYGINARVKMALGLSNEPLPAPEV
FT                   SRKPKVKPAPAHSPPPHAPAPVPHAPTREARAARTAPAPAREARPARVVAQAPRRTRPV
FT                   ATAGQAVVQPAPDYYAPAPAYAPAPAPASSRFGWW"
     atgctcccca ggcgcagggc cgccgcgctg gtcgcggtgc tgatggcggg agccgcgagc        60
     ctcgccggcg cgcgggcaca ggaggctgcc ccgcccgcaa gcccgcccga agcggcggcc       120
     cccacgccgc ccgcggccgc cgaggcgccc gtgcaggcca ccgagccgcc ggcagaaacc       180
     gccgcgccgc aggcacaacc ggccgaggct ccggctcagg ctgccgaggc atccaagccg       240
     ccgctgccgg atgatccggt cgcggcggcg atcgccacca agctcgcgga ttccaccgtt       300
     cccctcctgc gccgcttcgg gcgcagggag cgggaggcgc tccaggcctt ctacgcgctc       360
     ggggccttca agccggtctg gatcactgat ggcgcctgga ccgatgcggc caaggccgtg       420
     atcgcccggc tcggcgccgc cggggaggac gggctcgatc ctctcgacta cccgatcccg       480
     acgctcggca tcccgacggg ctcgcccgcc gacctcgcgg aggcggacct gaagctctcg       540
     gccgccgcgg cgctctatgc ccgcgacgca cggggcgggc gcatcgagcc gtcgcggctc       600
     tcgcggctca tcaccccgaa gctcgacctg cccagcgccg acgcggtgct gccgcggctc       660
     gccgccgccg ggccgggcgc caacgcggtg ctgcaatcct acaatccctc ccagacaggc       720
     tacctcgccc tgaaggcgaa gctcgcggcg ctccgcagcc agcggcccgg cggcgtgccg       780
     atggtgcgcc tgccgaaggg cccgaccctg aagcccggca tgcgcgacgc ccgcgtgccg       840
     ctgatccgcg cccggttcgg gctcgggcct gcggacgacg ccaccgccta cgacgcggcg       900
     gtcgcgggcg cggtcgagcg cttccagcgc gagcgggggc tcgccgccac cggaatcctc       960
     aatccggaga cggtcgcggc gctcgccggc ccctcgcccg ggcggcagga ggcggacctc      1020
     ctcgccaaca tggagcgctg gcgctggctg cccgccgacc tcggcaagac ccacgtctgg      1080
     gtcaacatcc ccgaatacaa ggtgcgggtg gtgtccggca cccgggtcgt ggacgaggcc      1140
     cgggtgatcg tcggcaagcc cgactcgccg acgccggtct tctccggcga gatgacctac      1200
     gcggtggtca acccgtcctg gaacgtgccg ccctcgatcc tcaagaacga gttcctgccc      1260
     cgcctcgccc gcgacccaac ctatgcggcc cgtctcggct acgaggtggt ccggcgcggc      1320
     aacggcatcg cgatccgcca gccgccgggc gagcgcaacg ccctcggctt catcaagttc      1380
     atgttcccga acgaccacgc ggtctatctc cacgacacgc cgaaccgggc gctcttcgcc      1440
     cgcagcgcgc gggccctgag ccacggctgc gtgcgcgtgg acgatccgtt ccgcttcgcg      1500
     gaggtggtgc tcggcccgac ctggccgacc gagcgcctca agcggctcat cggcaagggc      1560
     gagcggaccg tgatgctgcc cgagaagctg ccggtccacc tcgcctattt caccctggtg      1620
     gcggacgagg ccgggaccct gcgccagttc gacgacctct acggcatcaa tgcccgcgtg      1680
     aagatggccc tcggcctgtc gaacgagccc ctcccggccc cggaggtgtc ccgcaagccg      1740
     aaggtgaagc cggctcccgc gcattctcct cctcctcacg cgcccgcgcc cgttcctcat      1800
     gcgcccacgc gcgaggcgcg ggccgcccgc accgctcccg cgcccgcgcg cgaggcgcgg      1860
     cccgcccgcg tcgtcgccca ggcgccccgc cgcacgcgcc cggtcgccac ggcgggccag      1920
     gccgtggtgc agccggcccc ggactactac gccccggctc cggcttacgc gccggctccg      1980
     gcgcccgcct cctcccgctt cggctggtgg tga                                   2013
//

If you have problems or comments...

PBIL Back to PBIL home page