(data stored in ACNUC7421 zone)

EMBL: CP001349.PE209

CP001349.PE209       Location/Qualifiers
FT   CDS_pept        243210..244742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0216"
FT                   /product="protein of unknown function DUF882"
FT                   /note="PFAM: peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin; protein of unknown function DUF882;
FT                   Peptidase M15A; KEGG: met:M446_3151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55261"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K8"
FT                   /inference="protein motif:PFAM:PF05951"
FT                   /protein_id="ACL55261.1"
FT                   /translation="MAAAVARQDAGAETIVRALLRTGCRTAATLREFRSRSADVPRLRP
FT                   SLRRAGLAAAAVAAALVGGTRGTQDAAANGDTRTLSIIHEHTKESATVTFKRDGRYDRA
FT                   ALEQLNWLLRDWRIDEPTKMDPRLFDVVWEAHRASGSRDAVHIVSAYRSPQTNAALRRR
FT                   SRAVAEHSQHMLGKAMDFFLTDVSVDQIREIGMRMQRGGVGWYPHAYNPFVHLDVGSVR
FT                   AWPRMSYDQLARLFPDGRTVHLPRDGRPLPGYEVAKAEILARGGSVLGYGQAVAALDEE
FT                   DSPSVVGQFFSMLFGGGSKPAPAPAPAPQAPPRVRPVALASAAPDDAGTRGALAYAAQP
FT                   DPRAALLRDASPPPAAPGPAAAGPAEPPAPSEAAAPLPPRRPAEFAALAEALAAAPLPP
FT                   ARPAAVQIASADPAALGPLLPPRSSRSPVAEAAAGDAKAQLRALFVAAADPAAPQGSAV
FT                   QLTQARTASRGTPPAGLVAAPAGDVALRFQPRGPEAVDAGRFSGSAVKPGSR"
     atggcggccg ccgtcgcgcg gcaggatgcg ggagcggaga cgatcgtgcg agcgctgctg        60
     cggaccggct gccggacggc agcgaccctt cgcgagttcc ggtcccgcag cgcggatgtc       120
     cctcgtctcc gaccctccct gcgccgggcc gggctcgccg ccgcggcggt ggcggcggcg       180
     ctggtcggcg ggacccgcgg cacccaggac gcagccgcca acggcgacac ccggacgctc       240
     tcgatcatcc acgagcacac caaggagagt gcgaccgtca ccttcaagcg ggatgggcgc       300
     tacgaccggg cggcgctgga acagctcaac tggctcctgc gcgactggcg catcgacgag       360
     ccgaccaaga tggatccgcg cctcttcgac gtggtctggg aggcgcatcg ggccagcggg       420
     tctcgggacg cggtccatat cgtctcggcc taccggtcgc cgcagacgaa cgcggccctg       480
     cgccgccgct cccgcgcggt cgccgagcac agccagcaca tgctcggcaa ggcgatggat       540
     ttcttcctga ccgacgtctc ggtggaccag atccgcgaga tcggcatgcg gatgcagcgc       600
     ggcggggtcg gctggtaccc gcacgcctac aatcccttcg tgcatctcga tgtcggctcc       660
     gtgcgtgcct ggccacgcat gtcctacgac cagctggccc ggctgtttcc ggacgggcgc       720
     acggtccacc tgccgcggga cggccgcccg ctcccgggct acgaggtggc gaaggccgag       780
     atcctcgccc gcggcggctc ggtgctgggc tacggccaag ccgtcgcggc cctcgacgag       840
     gaggacagcc cgagcgtcgt cggccagttc ttcagcatgc tgttcggcgg cgggtcgaaa       900
     cctgccccgg ctccggctcc ggctccgcag gcgcccccgc gcgtgcggcc cgtggccctc       960
     gcgagcgcgg caccggacga tgcgggcacc cgcggcgccc tcgcctatgc ggcgcagccg      1020
     gatccgcgcg ccgcgttgct ccgcgacgca agccctccgc cggccgcacc gggccccgcc      1080
     gcggcgggcc cggccgaacc gcccgccccg tccgaggcgg ccgcgccgct gccgccgcgc      1140
     cgtccggccg agttcgccgc cctggccgag gcgctcgccg ccgcgccgct gccgcccgcg      1200
     cggccggccg ccgtccagat cgcgtcggcg gacccggcgg cgctcgggcc gctgctgcct      1260
     ccgcgctcat cccgctcgcc cgtcgccgag gccgcggcag gcgacgcgaa ggcccagctt      1320
     cgcgcgttgt tcgtcgccgc ggcggacccg gccgcgccac agggaagcgc cgtccagctc      1380
     acccaggccc gcacggcctc ccgcgggacg ccgccggcgg gtctcgtcgc cgcaccggcc      1440
     ggggacgtcg ccctgcggtt ccagccgcgc gggccggagg ccgtcgatgc cggccggttc      1500
     tcgggctctg ccgtcaagcc aggatcgcgc tga                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page