(data stored in ACNUC7421 zone)

EMBL: CP001349.PE21

CP001349.PE21        Location/Qualifiers
FT   CDS_pept        23879..24307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0022"
FT                   /product="response regulator receiver and SARP domain
FT                   protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   met:M446_0019 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55073"
FT                   /db_xref="GOA:B8IT11"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT11"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL55073.1"
FT                   /translation="MASVRGIEERASGVSTETSDQILNGARVLVVEDEAAISMLLEDML
FT                   LDFGCDIVGPAARLSTALEMAENETFAVAILDVNVAGEPIYPVAEAVVRRGLPLVFSTG
FT                   YGGAGIREPFRDRPVVQKPFSQQDLKRTLIAAIRGHSD"
     gtggcctcgg tgcgaggcat tgaggaaaga gcctccggcg tgagcacgga aacaagcgac        60
     cagatcctga atggggcccg cgtcctcgtc gtcgaggacg aagcggcgat ctcgatgctc       120
     ctggaggaca tgctcctcga tttcggctgc gacatcgtgg gtccggccgc gcggctgagc       180
     acggcgctcg aaatggccga gaacgagacc ttcgcggtcg cgatcctcga cgtcaacgtg       240
     gcgggcgagc cgatctatcc ggtcgccgag gccgtggtgc ggcgcggcct gccgctggtt       300
     ttctcgacgg gctatggcgg ggccgggatc cgcgagccgt tccgcgaccg gccggtggtg       360
     cagaagccct tcagccagca ggacctcaag cgcaccctga tcgcggcgat ccggggccat       420
     tcggactga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page