(data stored in ACNUC7421 zone)

EMBL: CP001349.PE210

CP001349.PE210       Location/Qualifiers
FT   CDS_pept        245210..246619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0218"
FT                   /product="Amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="PFAM: Amidase; KEGG: met:M446_3159 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55262"
FT                   /db_xref="GOA:B8I9K9"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K9"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ACL55262.1"
FT                   /translation="MTEIRHLDGAALLRRYRERSLSPREVVADVLSRTAAQEPAVNAFI
FT                   LADGEAALAAAAASEARWAAGAPCGPLDGLPVTIKDNIAWAGHPMRRGSRVSPETPLSE
FT                   NAPAVDRLLEAGAIPVGKTTMPEFGWKGLGDSTLTGITRNPWDLSRTTGGSSAGAAAAA
FT                   ALDLGLAHLGTDGAGSIRIPAAFCGVFGLKPSYGRVPAYPPSPFGPVAHLGPLARRVGD
FT                   AALMMRAIARPDARDMAAWLSEPPDYSAGLETGLRGLRVAWSPRLGFARQVDPEVAALT
FT                   AKAAAAFADLGAIVEEADPGFADPVETLNGIWLVGAWSVLRALPEDRRPEVEPALRAAA
FT                   ERGSRIAAPDFLAALNARAAVYTAMARFHARYDLLLTPSTAVAAFAAGHLTPPDGSYGE
FT                   DWLAWTPFSYPFNLTGQPAASVPCGLTRAGLPVGLQIVGPMGEDARVLAAARAFEAARP
FT                   WPVLDAPRQPT"
     atgacggaga tccggcacct cgacggagcg gcgctgctca ggcgctaccg cgaacgctcc        60
     ctgtcgccgc gcgaggtggt ggcggacgtg ctgtcccgaa ccgcggcgca ggagccggcg       120
     gtgaacgcct tcatcctggc cgacggggag gcggcgctcg cagcggccgc ggcctccgag       180
     gcacgctggg cggccggcgc cccctgcggc cccctcgacg ggctgcccgt gaccatcaag       240
     gacaacatcg cctgggcggg gcatccgatg cggcgcggct cgcgggtgag cccggagacg       300
     ccgctgtccg agaacgcccc cgcggtcgac cggctgctgg aggcgggggc gatcccggtc       360
     ggcaagacga cgatgccgga attcggctgg aagggcctcg gcgattcgac gctcaccggc       420
     atcacccgca atccctggga cctctcgcgc accaccggcg gctcctccgc gggggccgcc       480
     gccgcggcgg cgctcgatct cggcctcgcg catctcggca cggacggggc gggctcgatc       540
     cgcatcccgg ccgccttctg cggcgtgttc ggcctcaagc cgagctacgg gcgcgtgccg       600
     gcctatccac cctccccgtt cgggccggtg gcgcatctcg ggccgctggc ccggcgtgtc       660
     ggggacgcgg cgctgatgat gcgggcgatc gcacggccgg atgcgcggga catggcggcc       720
     tggctcagcg agccgccgga ctactcggcg ggcttggaga cgggcttgcg cggccttcgc       780
     gtcgcctgga gcccgcggct cggctttgcc cggcaggtcg atccggaggt ggcggcgctg       840
     acggcgaagg cggccgccgc ctttgcggat ctcggcgcga tcgtggagga ggcggatccg       900
     ggtttcgccg atccggtcga gaccctcaac ggcatctggc tcgtcggcgc ctggagcgtg       960
     ctgcgcgccc ttccggagga ccggcgtccc gaggtggagc ccgccctgcg ggcagcggcc      1020
     gagcggggca gccgcatcgc ggcgccggat ttcctcgccg cgctcaacgc gcgcgccgcg      1080
     gtctacaccg cgatggcgcg attccacgcg cgctacgacc tcctcctgac gccgtccacc      1140
     gccgtggcgg ccttcgcggc cggccatctc acgcctccgg acggctccta cggcgaggat      1200
     tggctcgcct ggaccccgtt ctcgtacccg ttcaacctca ccgggcaacc ggcggcgagc      1260
     gtgccttgcg gcctgacgcg agccgggctc ccggtcggcc tccagatcgt cgggccgatg      1320
     ggcgaggacg cgcgggtgct cgcggccgcc cgggccttcg aggcggcgcg gccctggccg      1380
     gtgctggacg cgccccggca gcccacctga                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page