(data stored in ACNUC7421 zone)

EMBL: CP001349.PE211

CP001349.PE211       Location/Qualifiers
FT   CDS_pept        246627..247130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0219"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82; KEGG:
FT                   met:M446_3160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55263"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L0"
FT                   /inference="protein motif:PFAM:PF01927"
FT                   /protein_id="ACL55263.1"
FT                   /translation="MAPLGPAPRWLCDEMLARLARLLRAAGHDTALAASGMPDRAILET
FT                   AEREERLLLTRDRRLAAAAGARALLIPENDPEEQARHLARHCGIDWNLARFTRCLMDNA
FT                   LLREAPPEEIAALPLSTRAGPGPFRACPVCGRIYWPGSHVRRMLDRLDRLAAAAGTPDP
FT                   GGRS"
     atggcgcccc tcggcccggc gccgcgctgg ctctgcgacg agatgctggc gcggctcgcg        60
     cgcctgctgc gcgcggccgg ccacgacacc gcgctcgccg catccggcat gccggatcgc       120
     gcgatcctgg agacggccga acgggaggag cgcctgctgc tcacccggga ccggcggctt       180
     gccgccgcgg ccggagcccg ggccctgctg atccccgaga acgatccgga ggaacaggcg       240
     cggcatctcg cgcgccattg cggcatcgac tggaacctcg cccggttcac gcgctgcctg       300
     atggacaatg cgcttctgcg ggaggcgccg cccgaggaga tcgcggccct gcccctctcc       360
     acccgggcgg ggcccggccc gttccgggcc tgcccggttt gcgggcggat ctactggccg       420
     ggcagccacg tccgccggat gctggaccgc ctcgaccggc tggccgccgc tgccggcacg       480
     ccggacccgg gcgggaggtc gtag                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page