(data stored in ACNUC7421 zone)

EMBL: CP001349.PE212

CP001349.PE212       Location/Qualifiers
FT   CDS_pept        247258..248010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0220"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /EC_number="3.1.3.12"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: trehalose-phosphatase; KEGG: met:M446_3162 HAD family
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55264"
FT                   /db_xref="GOA:B8I9L1"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L1"
FT                   /inference="protein motif:TFAM:TIGR01484"
FT                   /protein_id="ACL55264.1"
FT                   /translation="MTDTALALFLDFDGTLVDIAPRPDQVVVPAELPAALATLRGRLGG
FT                   ALAIVTGRPIATIDGFLAPERFDVGGLHGVEMRRGDRVAGCEPSAHPTLRAGVARLQDQ
FT                   TAPLEAVLIEDKGCSVAVHWRLATPTDARKAQDAVERLAADLGSAYRLQLGKAVGEILP
FT                   ATATKGHAIRAFQEDAPYAGRRAVFFGDDLTDEKAFATVNADGGVSVRIGGGETIAQHR
FT                   LAQPEDVRDLILRWAGGAPVDPEALPRA"
     gtgaccgata ccgcccttgc actgttcctg gacttcgacg gcacgctcgt cgacatcgcc        60
     ccgcggcccg atcaggtggt cgtgcccgcg gagcttcccg cggcgctcgc gacgctgcgc       120
     ggcaggctcg gcggcgcgct cgccatcgtc accggccgcc cgatcgccac gatcgacggc       180
     tttctcgcgc ccgagcgctt cgatgtcggc ggcctgcacg gcgtcgagat gcggcgcggc       240
     gaccgggtgg cgggctgcga gccctccgcc catccgacgc tccgtgcggg tgtcgcgcgg       300
     ctgcaggacc agaccgcccc gctcgaggcg gtgctgatcg aggacaaggg ctgctcggtg       360
     gcggtgcatt ggcgcctcgc gaccccgacc gacgcccgca aggcgcagga cgcggtcgag       420
     cgcctcgcgg cggatctcgg ctccgcctac cggctgcagc tcggcaaggc cgtgggcgag       480
     atcctgcccg cgacggccac caagggccat gcgatccggg ccttccagga agatgcgccc       540
     tatgcgggcc gccgcgccgt cttcttcggc gacgacctca ccgacgagaa ggccttcgcg       600
     accgtcaacg cggatggggg cgtgagcgtg cgcatcggcg ggggcgagac gatcgcgcag       660
     caccgcctcg cccagccgga ggatgtgcgc gacctcatcc tgcgctgggc cgggggtgcg       720
     ccggtcgatc ccgaggcgct gccgagggcg tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page